DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4835 and CG13806

DIOPT Version :9

Sequence 1:NP_647965.3 Gene:CG4835 / 38619 FlyBaseID:FBgn0035607 Length:1224 Species:Drosophila melanogaster
Sequence 2:NP_647708.1 Gene:CG13806 / 38292 FlyBaseID:FBgn0035325 Length:297 Species:Drosophila melanogaster


Alignment Length:446 Identity:81/446 - (18%)
Similarity:124/446 - (27%) Gaps:198/446 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LNVLAL--------PKIEPRHETCNNEQRYENQVMCEGKDFGALVPYPDNCSLFLVCDCLYPTVK 80
            ||::||        .:|:|| ||.:          |||:....  |..::|.|...|        
  Fly    13 LNLVALLMGATVTTRRIQPR-ETNS----------CEGRQSPG--PICESCELLATC-------- 56

  Fly    81 LCPANLWWDNKTQQCNYPQAVECIYYSIETPEPTDGTTRFTPEPTSSTQKITPEPTEPPSSTAKI 145
            :..:|.|.:...:.|:......|                                          
  Fly    57 VRHSNGWVNIPVESCDVANGYYC------------------------------------------ 79

  Fly   146 TTESTTGTSTEITSSTPSSYLPTSSWDPPPAPPGISDDY-CRNKEDGSVHYYPYDCQAYINCTYG 209
              .:..|:.|..|.              |..|.||..:: |.::   .:...|||||.|..|.:.
  Fly    80 --NARLGSCTNETG--------------PCHPFGIEGNFQCTSQ---GIFPDPYDCQKYHMCYFV 125

  Fly   210 WPVLNY----CIEDKVFNKYLGICDTPDMADCEELPLPTTTTEMPPTSTTEEDVVCGPTPEGIEE 270
            ...|..    |..||.|:...|.|                       :.|..|.||      ::.
  Fly   126 GATLVAAAVDCGNDKAFDATTGQC-----------------------TLTLTDSVC------LQR 161

  Fly   271 DYCVPKGNGFYEYPYNCSGYLACKNGCTDLDYCQPDKLFNNWLHICDTPDSVRCDPLPFPTTPGT 335
            .|..|.......:|.|.:.:..||:                                       |
  Fly   162 QYYCPNAGHVAAWPTNPNIFYVCKS---------------------------------------T 187

  Fly   336 TNKPTTPSVTTTPSITTTPSTPTTLPSDGST----------TEIHSSTTEEIVTTTDGLPSDVD- 389
            .|:....::...||:...        :||.|          ..:..||.:..|...|  |:|.| 
  Fly   188 VNQNLNDTIVIYPSLHRC--------NDGETFVDYVCRSGSNVLPPSTDDPSVIIED--PNDDDF 242

  Fly   390 ---PNDCKD---EKDGTIFAYIGNCSEYLICKDNQVQMGH--CPPNTLFNPDLLVC 437
               ||.|:.   ..||      .:|.:|..|......:.|  ||..|.:.|:|..|
  Fly   243 SVLPNTCQHVGLMADG------NDCRKYYYCSALNGTLRHMDCPNGTYYRPELSSC 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4835NP_647965.3 CBM_14 51..103 CDD:279884 10/51 (20%)
CBM_14 185..237 CDD:279884 15/55 (27%)
CBM_14 273..322 CDD:279884 5/48 (10%)
CBM_14 393..444 CDD:279884 13/50 (26%)
CBM_14 485..539 CDD:279884
CBM_14 585..638 CDD:279884
CBM_14 661..714 CDD:279884
CBM_14 744..796 CDD:279884
CBM_14 914..962 CDD:279884
CBM_14 1175..1212 CDD:279884
CG13806NP_647708.1 CBM_14 105..158 CDD:279884 16/78 (21%)
ChtBD2 247..293 CDD:214696 14/52 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443984
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.