DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4835 and obst-B

DIOPT Version :9

Sequence 1:NP_647965.3 Gene:CG4835 / 38619 FlyBaseID:FBgn0035607 Length:1224 Species:Drosophila melanogaster
Sequence 2:NP_609339.1 Gene:obst-B / 34336 FlyBaseID:FBgn0027600 Length:337 Species:Drosophila melanogaster


Alignment Length:353 Identity:77/353 - (21%)
Similarity:110/353 - (31%) Gaps:109/353 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 PTTTTEMPPTS---TTEEDVVCGPTPEGIEEDY-----CVPKGNGFYEYPYNCSGYLACKNGCTD 299
            |.:...:||.:   ..|..||........|::|     | |:.||||.....|..|.||.:|...
  Fly    48 PPSQRHLPPRNRDPVQEASVVPKSKQTAAEKEYEPTEEC-PEPNGFYPDSKQCDKYYACLDGVPT 111

  Fly   300 LDYCQPDKLFNNWLHICDTPDSVRCDPLPFPTTPGTTNKPTTPSVTTTPSITTTPSTPTTLPSDG 364
            ...|....:||::     :|...:|| ||:.......:|..||.    ||:              
  Fly   112 ERLCADGMVFNDY-----SPIEEKCD-LPYNIDCMKRSKLQTPQ----PSL-------------- 152

  Fly   365 STTEIHSSTTEEIVTTTDGLPSDVDPNDCKDEKDGTIFAYIGN-----CSEYLICKDNQVQMGHC 424
                                       .| ..|:|    |.|:     |.::..|.|.|..|..|
  Fly   153 ---------------------------HC-PRKNG----YFGHEKPGICDKFYFCVDGQFNMITC 185

  Fly   425 PPNTLFNPDLLVCDEPDDVVCLGDRTTTPIPTTIPTTTTEKTTPTTTTTTVATTLGPDQLCDGQE 489
            |...:|||...:|..||.|...|.::........|          ....::|.|           
  Fly   186 PAGLVFNPKTGICGWPDQVGVTGCKSEDVFDFECP----------KVNESIAVT----------- 229

  Fly   490 LGASFSYPDDCSKYYLCLGGGQWTLAPCIYGSYFDPSTGQCG-----PDVA------------PD 537
             ...::.|:||..:|:|:.|.......|..|..||.....|.     ||.|            .:
  Fly   230 -HPRYADPNDCQFFYVCVNGDLPRRNGCKLGQVFDEEKETCDWARKVPDCADWYKDRLTDKELDE 293

  Fly   538 ACKPSQVTTTTTTTTTETTTTERNTTPK 565
            ...|...||||.........:.|...||
  Fly   294 LENPKPKTTTTKRPPRVRGQSRRKPQPK 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4835NP_647965.3 CBM_14 51..103 CDD:279884
CBM_14 185..237 CDD:279884
CBM_14 273..322 CDD:279884 15/48 (31%)
CBM_14 393..444 CDD:279884 18/55 (33%)
CBM_14 485..539 CDD:279884 14/70 (20%)
CBM_14 585..638 CDD:279884
CBM_14 661..714 CDD:279884
CBM_14 744..796 CDD:279884
CBM_14 914..962 CDD:279884
CBM_14 1175..1212 CDD:279884
obst-BNP_609339.1 CBM_14 89..139 CDD:279884 17/55 (31%)
CBM_14 156..204 CDD:279884 17/51 (33%)
CBM_14 233..278 CDD:279884 12/44 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444064
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.