DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4835 and obst-E

DIOPT Version :9

Sequence 1:NP_647965.3 Gene:CG4835 / 38619 FlyBaseID:FBgn0035607 Length:1224 Species:Drosophila melanogaster
Sequence 2:NP_723116.1 Gene:obst-E / 33806 FlyBaseID:FBgn0031737 Length:249 Species:Drosophila melanogaster


Alignment Length:293 Identity:62/293 - (21%)
Similarity:80/293 - (27%) Gaps:121/293 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 FGALV------PYP-------DNCSLFLVCDCLYPTVKLCPANLWWDNKTQQCNYPQAVECIYYS 107
            ||::.      |.|       |.|..:..|....|..||||..|.:..:|               
  Fly    15 FGSMALGSPECPTPNGRFASGDQCDSYTECQDGTPVEKLCPDGLLFHQRT--------------- 64

  Fly   108 IETPEPTDGTTRFTPEPTSSTQKITPEPTEPPSSTAKITTESTTGTSTEITSSTPSSYLPTSSWD 172
                                  |.|.|.|..|.||.|..........||   ..|..:       
  Fly    65 ----------------------KATGECTYAPYSTCKERARLQPANGTE---ECPRQF------- 97

  Fly   173 PPPAPPGISDDYCRNKEDGSVHYYP----YDCQAYINCTYGWPVLNYCIEDKVFNKYLGICDTPD 233
                                 .:||    ..|..|.||.:|...|..|.|...||:....||.||
  Fly    98 ---------------------GFYPNGDATKCGVYRNCAHGVASLTKCPEGLAFNEETYQCDWPD 141

  Fly   234 MAD-----------CEELPLPTTTTEMPPTSTTEEDVVCGP---TPEGIEEDYCVPKGNGFYEYP 284
            :.:           |             |.:.:.:|.....   :||| |..|        |.:|
  Fly   142 LVESCNAEAYLGFNC-------------PAADSADDSAAAAVDVSPEG-ELRY--------YRHP 184

  Fly   285 YNCSGYLACKNGCTDLDYCQPDKLFNNWLHICD 317
            ..|..|..|.||...|..|.....||:...:||
  Fly   185 QTCKKYFVCVNGHPRLYNCGKYLAFNSQTKLCD 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4835NP_647965.3 CBM_14 51..103 CDD:279884 14/59 (24%)
CBM_14 185..237 CDD:279884 16/66 (24%)
CBM_14 273..322 CDD:279884 13/45 (29%)
CBM_14 393..444 CDD:279884
CBM_14 485..539 CDD:279884
CBM_14 585..638 CDD:279884
CBM_14 661..714 CDD:279884
CBM_14 744..796 CDD:279884
CBM_14 914..962 CDD:279884
CBM_14 1175..1212 CDD:279884
obst-ENP_723116.1 ChtBD2 23..65 CDD:214696 12/78 (15%)
CBM_14 95..146 CDD:307643 16/78 (21%)
CBM_14 180..225 CDD:307643 14/46 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.