DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4835 and CG42728

DIOPT Version :9

Sequence 1:NP_647965.3 Gene:CG4835 / 38619 FlyBaseID:FBgn0035607 Length:1224 Species:Drosophila melanogaster
Sequence 2:NP_001189111.1 Gene:CG42728 / 10178859 FlyBaseID:FBgn0261681 Length:156 Species:Drosophila melanogaster


Alignment Length:143 Identity:44/143 - (30%)
Similarity:62/143 - (43%) Gaps:22/143 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   392 DCKDEKDGTIFAYIGNCSEYLICKDNQVQMGHCPPNTLFNPDLLVCDEPDDVVCLGDRTTTPIPT 456
            :|..: :|.|.....||:..||....|..| .|..||..|.: ..|   .|::.:.:.|..||.|
  Fly    30 ECSGQ-NGFINNTRSNCNYSLINCSGQNSM-FCTDNTTCNAN-FTC---SDILPVDNSTALPIST 88

  Fly   457 TIPTTTTEKTTPTTTTTTVATTLGPDQL---CDGQELGASFSYPDDCSKYYLCLGGGQWTLAPCI 518
            |           ....||.:||:.|..:   | .|.:...||||.:|:.:|.|: .|...:..|.
  Fly    89 T-----------PNVVTTASTTVSPSDIRREC-RQGVTKRFSYPQNCNYFYYCV-DGFLLVEQCP 140

  Fly   519 YGSYFDPSTGQCG 531
            .|..|||.||.||
  Fly   141 IGYAFDPQTGACG 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4835NP_647965.3 CBM_14 51..103 CDD:279884
CBM_14 185..237 CDD:279884
CBM_14 273..322 CDD:279884
CBM_14 393..444 CDD:279884 15/50 (30%)
CBM_14 485..539 CDD:279884 19/47 (40%)
CBM_14 585..638 CDD:279884
CBM_14 661..714 CDD:279884
CBM_14 744..796 CDD:279884
CBM_14 914..962 CDD:279884
CBM_14 1175..1212 CDD:279884
CG42728NP_001189111.1 CBM_14 117..152 CDD:279884 15/35 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.