DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir64a and GLR2.5

DIOPT Version :9

Sequence 1:NP_647962.1 Gene:Ir64a / 38616 FlyBaseID:FBgn0035604 Length:859 Species:Drosophila melanogaster
Sequence 2:NP_001332219.1 Gene:GLR2.5 / 830991 AraportID:AT5G11210 Length:918 Species:Arabidopsis thaliana


Alignment Length:521 Identity:91/521 - (17%)
Similarity:156/521 - (29%) Gaps:178/521 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   355 DMFNWTFVLSR---TTSWGYV--------KNGRFDGMIGALIRNETD--IGGAPIFYWLERHKWI 406
            |:||  .|:|:   ..|:.|:        ..|.:|.|:..:...|.|  :|...|.  ..|..::
plant   491 DVFN--TVMSQMPYAVSYEYIPFDTPDGKPRGSYDEMVYNVFLGEFDGAVGDTTIL--ANRSHYV 551

  Fly   407 DVAGRSWSSRPCFIFRHPRSTQKDRIVFLQPFTNDVWILIVGCGVLTVFILWFLTTIEWKLVPHD 471
            |.|.....:...|:.......:|...|||:|.|.::|::.....:....::|..           
plant   552 DFALPYSETGIVFLVPVKDGKEKGEWVFLKPLTKELWLVTAASFLYIGIMVWIF----------- 605

  Fly   472 GSALIKPKGGAPPRHHYQQQQQQEQVEAPVRPITAVSVVVSKEKVEEKQEEYEDSTPIDAGTLWQ 536
                           .||                             ..||:.:...||.     
plant   606 ---------------EYQ-----------------------------ADEEFREQMIIDK----- 621

  Fly   537 RCYQKLNKYIKDRKAKQKKAPERVGLFLESVLFFVGIICQQGLGFSTSFVS---------GRCIV 592
                                       :.||.:|         .|||.|.:         .|.:|
plant   622 ---------------------------ISSVFYF---------SFSTLFFAHRRPSESFFTRVLV 650

  Fly   593 ITSLLFSFCIYQFYSASIVGTLLMEKPK-TIKTLSDLVHSSLKVGMEDILYNRDYFLHTKDPVSM 656
            :........:.|.|:|::...|.:::.: |::.:.||..|.:.:|     |....|...:     
plant   651 VVWCFVLLILTQSYTATLTSMLTVQELRPTVRHMDDLRKSGVNIG-----YQTGSFTFER----- 705

  Fly   657 ELYAKKITSVPTTKENEADEDEPVDPNPVSTDPAKSYRDIVHSHETGAHAKDNAASNWLDPETGL 721
                        .|:...||..           .|:|.......|...|...|...:....|...
plant   706 ------------LKQMRFDESR-----------LKTYNSPEEMRELFLHKSSNGGIDAAFDEVAY 747

  Fly   722 LRHLGFAFHVDVAAAYKIIAETFSEQDICDLTEVSMFPPQKTVSIMQKNSPMRKVISYGLRRVTE 786
            ::    .|.....:.|.||..||.....     ...||         ..||:...||..:..:||
plant   748 IK----LFMAKYCSEYSIIEPTFKADGF-----GFAFP---------LGSPLVSDISRQILNITE 794

  Fly   787 TGILTYHFNVWHSRKPPCVKKIETSDLHVDMDTVS-SALLILLF--SYAITLMILGTEILYSKWH 848
            ...:....|.|...:..|:.. .|||..:.:|..| .||.:::|  |..:.|::|.:.....:.|
plant   795 GDAMKAIENKWFLGEKHCLDS-TTSDSPIQLDHHSFEALFLIVFVVSVILLLLMLASRGYQERQH 858

  Fly   849 N 849
            |
plant   859 N 859

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir64aNP_647962.1 Periplasmic_Binding_Protein_Type_2 351..>465 CDD:304360 26/122 (21%)
Lig_chan 563..828 CDD:278489 53/275 (19%)
GLR2.5NP_001332219.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18966
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.