DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir64a and GLR2.3

DIOPT Version :9

Sequence 1:NP_647962.1 Gene:Ir64a / 38616 FlyBaseID:FBgn0035604 Length:859 Species:Drosophila melanogaster
Sequence 2:NP_001325281.1 Gene:GLR2.3 / 817007 AraportID:AT2G24710 Length:919 Species:Arabidopsis thaliana


Alignment Length:388 Identity:78/388 - (20%)
Similarity:126/388 - (32%) Gaps:168/388 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   375 GRFDGMIGALIRNETDIGGAPIFYWLERHKWIDVAGRSWSSRPCFIFRHPRSTQKDRIVFLQPFT 439
            ||:|.::|     :|.|       .:.|..::|.......|....|.......::|.|:|::|.:
plant   552 GRYDAVVG-----DTTI-------LVNRSSYVDFTFPFIKSGVGLIVEMTDPVKRDYILFMKPLS 604

  Fly   440 NDVWI------LIVGCGVLTVFILWFLTTIEWKLVPHDGSALIKPKGGAPPRHHYQQQQQQEQVE 498
            ..:|:      .:|||   ||::|      |:|.         .|....|||           .:
plant   605 WKLWLTSFISFFLVGC---TVWVL------EYKR---------NPDFSGPPR-----------FQ 640

  Fly   499 APVRPITAVSVVV--SKEKVEEKQEEYEDSTPIDAGTLWQRCY---------------------- 539
            |......|.|.:|  .:|:|               .:.|.|..                      
plant   641 ASTICWFAFSTMVFAPRERV---------------FSFWARALVIAWYFLVLVLTQSYTASLASL 690

  Fly   540 ---QKLNKYIKDRKAKQKKAPERVGLFLESVLFFVGIICQQG------LGFSTS----------- 584
               ||||..|....:..:|. |.||  .:...|.:|.:.::|      :.|.|:           
plant   691 LTSQKLNPTITSMSSLLEKG-ETVG--YQRTSFILGKLKERGFPQSSLVPFDTAEECDELLSKGP 752

  Fly   585 ---FVSGRCIVITSL---LFSFC-IYQFYSASIVGTLLMEKPKTI-----------KTLSDLVHS 631
               .|||..:.|..|   |..|| .|:          ::|:|..:           ..::|:..:
plant   753 KKGGVSGAFLEIPYLRLFLGQFCNTYK----------MVEEPFNVDGFGFVFPIGSPLVADVSRA 807

  Fly   632 SLKVGMEDILYNRDYFLHTKDPVSMEL----YAKKITSVPTTKENEADEDEPV---DPNPVST 687
            .|||              .:.|.:|||    :.||..|.|          :|:   ||||..|
plant   808 ILKV--------------AESPKAMELERAWFKKKEQSCP----------DPITNPDPNPSFT 846

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir64aNP_647962.1 Periplasmic_Binding_Protein_Type_2 351..>465 CDD:304360 21/95 (22%)
Lig_chan 563..828 CDD:278489 34/167 (20%)
GLR2.3NP_001325281.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18966
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.