DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir64a and Ir68b

DIOPT Version :10

Sequence 1:NP_647962.1 Gene:Ir64a / 38616 FlyBaseID:FBgn0035604 Length:859 Species:Drosophila melanogaster
Sequence 2:NP_648548.1 Gene:Ir68b / 39378 FlyBaseID:FBgn0036250 Length:635 Species:Drosophila melanogaster


Alignment Length:146 Identity:35/146 - (23%)
Similarity:51/146 - (34%) Gaps:43/146 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 YINGNSNNGFWDQRDHNKKPERNGESDYLVELKCGPRANAKTRPPSESSPLKQ--NNSFALALRR 197
            |....||||.......|.    |.|...::||:.            |.||..:  |....:||  
  Fly   215 YYGAKSNNGKSVVMSFNV----NSEDFSVIELEV------------EISPYWRLVNYKGDIAL-- 261

  Fly   198 EMYNLPDFQTDYEDAKFFVIKSYSEDDVHKSIKYSVWSSTIN----------GNKKLDAA----- 247
             |.|:.|......:.:.:|....:.:....|||.|.|:.|::          |.|:|..|     
  Fly   262 -MNNIEDSLYHSREFEMWVRNEVTGNWDRTSIKISHWNGTVDGKTFYFKGTIGTKELAFAPDYWF 325

  Fly   248 -------FRDAETKTL 256
                   :.|.|||.|
  Fly   326 GEQHFVSYYDTETKNL 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir64aNP_647962.1 Periplasmic_Binding_Protein_Type_2 351..>465 CDD:473866
Lig_chan 563..828 CDD:459656
Ir68bNP_648548.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.