DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir64a and Ir21a

DIOPT Version :9

Sequence 1:NP_647962.1 Gene:Ir64a / 38616 FlyBaseID:FBgn0035604 Length:859 Species:Drosophila melanogaster
Sequence 2:NP_001097043.1 Gene:Ir21a / 33157 FlyBaseID:FBgn0031209 Length:842 Species:Drosophila melanogaster


Alignment Length:434 Identity:87/434 - (20%)
Similarity:130/434 - (29%) Gaps:154/434 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ELELDYGLAEPQRTSLLQ---SSLILQFSQDYKHIPRITYFTCQKPHLQTPNQIPNAAEHRDAFA 84
            |:..||.....:.||.:.   .|.||..|..                |.|...:....|.|....
  Fly   145 EINADYEAKNKRFTSHIDCNCKSYILFLSDP----------------LMTRKILGPQTESRVVLV 193

  Fly    85 AKNFQ-LIKSLYESELFVRIVLLDVLAQS----PTSGRP--------NRPGNGPTGGFSQTPSQA 136
            :::.| .::....|||...||.|.|:.:|    |...||        ...|.|     |.||...
  Fly   194 SRSTQWRLRDFLSSELSSNIVNLLVIGESLMADPMRERPYVLYTHKLYADGLG-----SNTPVVL 253

  Fly   137 QSNSEWLEGVLRMEALRQIAVVDLACGAVSRRFLELASAKMLYSEKFHWLLIE-----DFAWHGR 196
            .|   |::                  ||:||..:.|..:|..:....|...|.     .|.:..|
  Fly   254 TS---WIK------------------GALSRPHINLFPSKFQFGFAGHRFQISAANQPPFIFRIR 297

  Fly   197 TQTAEGSGK-RDDG---------------EMEEEEPPGQQ----IQATDDEDLPSIESFLGGMNL 241
            |..:.|.|: |.||               .::..|.|.:.    :..|..|.:......:|...:
  Fly   298 TLDSSGMGQLRWDGVEFRLLTMISKRLNFSIDITETPTRSNTRGVVDTIQEQIIERTVDIGMSGI 362

  Fly   242 YMNTELTLAKRMSE------AAHYTLFDVWNPGLNYGGHVNLTEIGSFTPTEGIQLHTWFRTTST 300
            |:..|..:...||.      ||..||.....|...       ..:|.|      |...|      
  Fly   363 YITQERLMDSAMSVGHSPDCAAFITLASKALPKYR-------AIMGPF------QWPVW------ 408

  Fly   301 VRRRMDMQHARVRCM-------VVVTNKNMTGTLMYYLTHTMS--GHIDTMNRFNFNLLMAVRDM 356
                     ..:.|:       :|.|:: :|      |:|.|.  |.::       |:...|..|
  Fly   409 ---------VALICVYLGGIFPIVFTDR-LT------LSHLMGNWGEVE-------NMFWYVFGM 450

  Fly   357 FNWTFVLSRTTSWGYVKNGRFDGMIGALIRNETDIGGAPIFYWL 400
            |...|..:...||...:......:|||              |||
  Fly   451 FTNAFSFTGKYSWSNTRKNSTRLLIGA--------------YWL 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir64aNP_647962.1 Periplasmic_Binding_Protein_Type_2 351..>465 CDD:304360 12/50 (24%)
Lig_chan 563..828 CDD:278489
Ir21aNP_001097043.1 Periplasmic_Binding_Protein_Type_2 289..583 CDD:304360 47/248 (19%)
Lig_chan 407..662 CDD:278489 22/117 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.