DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir64a and Ir7g

DIOPT Version :9

Sequence 1:NP_647962.1 Gene:Ir64a / 38616 FlyBaseID:FBgn0035604 Length:859 Species:Drosophila melanogaster
Sequence 2:NP_001368933.1 Gene:Ir7g / 31694 FlyBaseID:FBgn0029968 Length:607 Species:Drosophila melanogaster


Alignment Length:267 Identity:57/267 - (21%)
Similarity:95/267 - (35%) Gaps:72/267 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   596 LLFSFCIYQFYSASIVGTLLMEKPKTIK-TLSDLVHSSL-----KVGMEDILYNRDYFLHTKDPV 654
            |:|...:...|||.:...|.....:.:. .|.||.|...     :..::|:         .:.|.
  Fly   393 LIFGLIVRSMYSALLFFILRYHLHQRLPGNLQDLTHGDYAAVMGRTTLQDL---------REVPS 448

  Fly   655 SMELYAKKITSVPTTKENEADEDEPVDPNPVSTDPAKSYRDIVHSHET--GAHAKDNAASNWLDP 717
            ..:|...|  ||..|.|.|.:....:|        ..:.|:...||..  |..::|         
  Fly   449 LQDLLGLK--SVIVTSEREEEVLRTLD--------RCTLREGAGSHPLFFGLISQD--------- 494

  Fly   718 ETGLLRHLGFAFHVDVAAAYKIIAETFSEQDICDLTEVSMFPPQKTVSIMQKNSPMRKVISYGLR 782
               .|.||....|  .|.||.||     .||:.:         |:....:||:|.:...:.:.:.
  Fly   495 ---ALLHLTQRGH--RAGAYHII-----PQDVLE---------QQLAIYLQKHSHLASHLDHLVM 540

  Fly   783 RVTETGILTYHF-------NVWHSRKPPCVKKIETSDLHVDMDTVSSALLILLFS-YAITLMILG 839
            .:...| |.:|:       ..:.||.....|:|...||.        |:.||... |.::|::..
  Fly   541 SIRSVG-LVHHWAGQMASERYFRSRFLYREKRIRQPDLW--------AVYILTAGLYLLSLVVFI 596

  Fly   840 TEILYSK 846
            .|:|.|:
  Fly   597 CELLASR 603

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir64aNP_647962.1 Periplasmic_Binding_Protein_Type_2 351..>465 CDD:304360
Lig_chan 563..828 CDD:278489 51/246 (21%)
Ir7gNP_001368933.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462939
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.