Sequence 1: | NP_647962.1 | Gene: | Ir64a / 38616 | FlyBaseID: | FBgn0035604 | Length: | 859 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001245572.1 | Gene: | Ir7c / 31692 | FlyBaseID: | FBgn0029966 | Length: | 625 | Species: | Drosophila melanogaster |
Alignment Length: | 283 | Identity: | 58/283 - (20%) |
---|---|---|---|
Similarity: | 86/283 - (30%) | Gaps: | 116/283 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 234 SFLGGMNLYMNTELTLAKRMSEAAHYTLFDVWNPGLNYGGHVNLTEIGSFTPTEGIQLHTWFRTT 298
Fly 299 STVRRRMDMQHARVRCMVVVTNKNMTGTLMYYLTHT-MSGHIDTMNR-----FNFNLLMAVRDMF 357
Fly 358 -------NWTFVLSRTTSWGYVKNGRFDGMIGALIR---NETDIGGAPIFYWLERHKWIDVAGRS 412
Fly 413 WSSRPCFIFRHPRSTQK---DRIVF---------------------------LQPFTNDVWIL-- 445
Fly 446 -IVGCG-----VLTVFILWFLTT 462 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ir64a | NP_647962.1 | Periplasmic_Binding_Protein_Type_2 | 351..>465 | CDD:304360 | 37/160 (23%) |
Lig_chan | 563..828 | CDD:278489 | |||
Ir7c | NP_001245572.1 | Lig_chan-Glu_bd | 225..287 | CDD:214911 | |
Lig_chan | 343..593 | CDD:278489 | 50/266 (19%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45462935 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1052 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.830 |