DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir64a and Ir41a

DIOPT Version :9

Sequence 1:NP_647962.1 Gene:Ir64a / 38616 FlyBaseID:FBgn0035604 Length:859 Species:Drosophila melanogaster
Sequence 2:NP_995744.4 Gene:Ir41a / 2768714 FlyBaseID:FBgn0040849 Length:648 Species:Drosophila melanogaster


Alignment Length:135 Identity:36/135 - (26%)
Similarity:59/135 - (43%) Gaps:16/135 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   335 MSGHIDTMNRF----NFNLLMAVRDMFNWTFVL--SRTTSWGYV-KNGRFDGMIGALIRNETDIG 392
            :||..|..|.:    ...:::...:.||.|..:  |....||.| .|...||.:|.||..:.||.
  Fly   239 VSGESDFKNVYIDGTETRIVLNFCEQFNCTIQIDSSAANDWGKVYPNMSGDGALGMLINRKADIC 303

  Fly   393 GAPIFYWLERHKWIDVA---GRSWSSRPCFIFRHPRSTQKDRIVFLQPFTNDVW--ILIVGCGVL 452
            ...::.|.|.:.::|::   .||..:  |.:....|.|  ...:.|:||...:|  ||:..|...
  Fly   304 IGAMYSWYEDYTYLDLSMYLVRSGIT--CLVPAPLRLT--SWYLPLEPFKETLWAAILLCLCAEA 364

  Fly   453 TVFIL 457
            |..:|
  Fly   365 TGLVL 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir64aNP_647962.1 Periplasmic_Binding_Protein_Type_2 351..>465 CDD:304360 32/115 (28%)
Lig_chan 563..828 CDD:278489
Ir41aNP_995744.4 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462937
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.