DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir64a and Grin2d

DIOPT Version :9

Sequence 1:NP_647962.1 Gene:Ir64a / 38616 FlyBaseID:FBgn0035604 Length:859 Species:Drosophila melanogaster
Sequence 2:XP_038951440.1 Gene:Grin2d / 24412 RGDID:2740 Length:1334 Species:Rattus norvegicus


Alignment Length:290 Identity:57/290 - (19%)
Similarity:104/290 - (35%) Gaps:85/290 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 NPGLNYGGHVNLTE------IGSF-TPTEGIQLHTWFRTTSTVRRRMDMQHARV-----RCMVVV 318
            ||.|..   ::||.      :||: ..|..::...|.|....::...|.||..|     |..|:|
  Rat   381 NPSLVV---ISLTRDRTWEVVGSWEQQTLRLKYPLWSRYGRFLQPVDDTQHLTVATLEERPFVIV 442

  Fly   319 TNKN-MTGTLM-------YYLTHTMSGHIDT-------MNRFNFNLLMAVRDMFNWTFVLSRTTS 368
            ...: ::||.:       ..|..|.|...|.       ...|..::|..:.....:::.|...|:
  Rat   443 EPADPISGTCIRDSVPCRSQLNRTHSPPPDAPRPEKRCCKGFCIDILKRLAHTIGFSYDLYLVTN 507

  Fly   369 WGYVK--NGRFDGMIGALIRNETDIGGAPIFYWLERHKWID-------------VAGRSWSSRP- 417
            ..:.|  :|.::||||.:.....|:....:....||.:.:|             ||..:.:..| 
  Rat   508 GKHGKKIDGVWNGMIGEVFYQRADMAIGSLTINEERSEIVDFSVPFVETGISVMVARSNGTVSPS 572

  Fly   418 ---CFIFRHPRSTQKDRIVFLQPFTNDVWILI-VGC---GVLTVFILWFLTTIE----------- 464
               .|.:..|..:.       :|::..||::: |.|   ..:||||..:|:.:.           
  Rat   573 AFLAFAWLTPPMSP-------EPYSPAVWVMMFVMCLTVVAVTVFIFEYLSPVGYNRSLATGKRP 630

  Fly   465 --------------WKLVPHDGSALIKPKG 480
                          |.||.::...:..|:|
  Rat   631 GGSTFTIGKSIWLLWALVFNNSVPVENPRG 660

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir64aNP_647962.1 Periplasmic_Binding_Protein_Type_2 351..>465 CDD:304360 27/161 (17%)
Lig_chan 563..828 CDD:278489
Grin2dXP_038951440.1 PBP1_iGluR_NMDA_NR2 46..410 CDD:380601 8/31 (26%)
PBP2_iGluR_NMDA_Nr2 427..838 CDD:270436 46/241 (19%)
PHA03307 <1125..>1312 CDD:223039
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350043
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.