DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir64a and Grin2b

DIOPT Version :10

Sequence 1:NP_647962.1 Gene:Ir64a / 38616 FlyBaseID:FBgn0035604 Length:859 Species:Drosophila melanogaster
Sequence 2:NP_036706.1 Gene:Grin2b / 24410 RGDID:2738 Length:1482 Species:Rattus norvegicus


Alignment Length:236 Identity:48/236 - (20%)
Similarity:79/236 - (33%) Gaps:64/236 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   280 IGSFTPTEGIQLHTWFRTTSTVRRRMDMQHARVRCMVVVTNKNMTGTLMYYLTHTMSGHIDTMNR 344
            :.|..|..|    |..|.|             |.|...:.::|.|.....|:.....|       
  Rat   419 VESVDPLSG----TCMRNT-------------VPCQKRIISENKTDEEPGYIKKCCKG------- 459

  Fly   345 FNFNLLMAVRDMFNWTFVLSRTTSWGYVK--NGRFDGMIGALIRNETDIGGAPIFYWLERHKWID 407
            |..::|..:.....:|:.|...|:..:.|  ||.::||||.::.....:....:....||.:.:|
  Rat   460 FCIDILKKISKSVKFTYDLYLVTNGKHGKKINGTWNGMIGEVVMKRAYMAVGSLTINEERSEVVD 524

  Fly   408 VAGRSWSSRPCFIFRHPRSTQKDRIVFLQPFTNDVWI------LIVGCGVLTVF----------- 455
            .:.....:....:......|.... .||:||:.|||:      |||....:.||           
  Rat   525 FSVPFIETGISVMVSRSNGTVSPS-AFLEPFSADVWVMMFVMLLIVSAVAVFVFEYFSPVGYNRC 588

  Fly   456 ----------------ILWFLTTIEWKLVPHDGSALIKPKG 480
                            .:|.|    |.||.::...:..|||
  Rat   589 LADGREPGGPSFTIGKAIWLL----WGLVFNNSVPVQNPKG 625

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir64aNP_647962.1 Periplasmic_Binding_Protein_Type_2 351..>465 CDD:473866 28/148 (19%)
Lig_chan 563..828 CDD:459656
Grin2bNP_036706.1 PBP1_iGluR_NMDA_NR2 33..388 CDD:380601
PBP2_iGluR_NMDA_Nr2 403..803 CDD:270436 48/236 (20%)
Pore-forming. /evidence=ECO:0000269|PubMed:24876489, ECO:0000305|PubMed:24876489 604..623 5/22 (23%)
NMDAR2_C 840..1482 CDD:463148
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1161..1194
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1269..1301
Interaction with DAPK1. /evidence=ECO:0000250|UniProtKB:Q01097 1292..1304
PDZ-binding 1480..1482
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.