DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir64a and T25E4.2

DIOPT Version :9

Sequence 1:NP_647962.1 Gene:Ir64a / 38616 FlyBaseID:FBgn0035604 Length:859 Species:Drosophila melanogaster
Sequence 2:NP_001364710.1 Gene:T25E4.2 / 188897 WormBaseID:WBGene00020804 Length:455 Species:Caenorhabditis elegans


Alignment Length:257 Identity:50/257 - (19%)
Similarity:100/257 - (38%) Gaps:54/257 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   561 GLFLESVLFFVGIICQQGLGFSTSFV----SGRCIVITS---LLFSFCIYQFYSASIVGTLLMEK 618
            ||.:.|:|.::.|.|.   |....|:    |..|.::..   ||....|..:|.|.:...||:..
 Worm   148 GLRVRSLLDWMFISCS---GIIHQFMFRISSPICALVLIGFWLLCCLVIITYYEAKLKSFLLLSH 209

  Fly   619 PK-TI-KTLSDLVHSSLKVGMEDILYNRDY----FLHTKDPVSMELYAKKITSVPTTKENEAD-- 675
            .: || .||..::.::...|...::..|.|    :.:......::....:|..:..  :::|:  
 Worm   210 HRGTIFNTLDGVLEAAEHKGWTLVIQERGYTPYLYCNPSQCARLDRLKSRINFIGA--DDDANLL 272

  Fly   676 --EDEPVDPNPVSTDPAKSYRDIVH--SHETGAHAKDNAASNWLDPETGLLRHLGFAFHVDVAAA 736
              :|:.|..:.:::|.|::  ||.:  .|......:|..    :.||     :|.:|.:.:|...
 Worm   273 LGQDKHVGFSALASDLAET--DITYFDYHSKILFVRDKI----MAPE-----YLAYAVNKNVKGL 326

  Fly   737 ----YKIIAETFSEQDICDLTEVSMFPPQKTVSIMQKNSPMRKVISYGLRRVTETGILTYHF 794
                .:.:|.|.|.........::.||...:|:...:               |.|.:.|.||
 Worm   327 REKFNRAVAYTKSGYGTVRSRYIASFPSYNSVTSQSQ---------------TITVLQTSHF 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir64aNP_647962.1 Periplasmic_Binding_Protein_Type_2 351..>465 CDD:304360
Lig_chan 563..828 CDD:278489 48/255 (19%)
T25E4.2NP_001364710.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.