DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir64a and glr-6

DIOPT Version :9

Sequence 1:NP_647962.1 Gene:Ir64a / 38616 FlyBaseID:FBgn0035604 Length:859 Species:Drosophila melanogaster
Sequence 2:NP_741822.2 Gene:glr-6 / 180955 WormBaseID:WBGene00001617 Length:844 Species:Caenorhabditis elegans


Alignment Length:344 Identity:69/344 - (20%)
Similarity:109/344 - (31%) Gaps:110/344 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 LACGAVSRRFLELASAKMLYSEKFHWLLIEDFAWHGRTQTAEGSGKRDDGEMEEEEPPGQQIQAT 224
            |||.|..||.:.....:.:  :||...:::.|.......:..|:..|.|.|:.            
 Worm   311 LACQAGDRRIISCGDNEAV--KKFKLPIVKPFKGLTGKISFNGTSDRSDSELH------------ 361

  Fly   225 DDEDLPSIESFLGGMNLYMNTELTLAKRMSEAAHYTLFDVWNPGLNYGGHVNLTEIGSFTPTEGI 289
                                                   :|..|        :|..|..|   ||
 Worm   362 ---------------------------------------IWEMG--------ITGAGLHT---GI 376

  Fly   290 QLHTWFRTTSTVRRRMDMQHARVRCMVVVTNKNMTGTLMYYLT-------------HTMSGHIDT 341
            ...||             :.::...|:.   ||:.||..:|..             |.....|:.
 Worm   377 WKSTW-------------EGSKELTMLA---KNIPGTHEHYQASVRESRTLKVTSIHEKPYVIEK 425

  Fly   342 M--------NRFNFNLLMAVRDM--FNWTFVLSRTTSWGYVKNG--RFDGMIGALIRNETDIGGA 394
            :        ..|..:||..:.:|  ||:|..:.:...:|..|||  .:|||||.::|.:.|:..|
 Worm   426 IMPDGRIKHEGFCVDLLDKLAEMLHFNYTLKIVKDNKYGERKNGTDEWDGMIGEILRGDADMAVA 490

  Fly   395 PIFYWLERHKWIDVAGRSWSSRPCFIFRHPRSTQKDRIV-FLQPFTNDVWILIVGCGVLTVFILW 458
            ||.....|.:.||............:.|.|.......:. ||.|.:..||.......|:|.    
 Worm   491 PITVTATRLEVIDFTDPFLQLGISMLMRQPNPKSSSSLTRFLWPLSASVWTFSAIATVITA---- 551

  Fly   459 FLTTIEWKLVPHDGSALIK 477
            .|.|:...|.|.:.:|..|
 Worm   552 LLVTVAAVLSPKESTAEFK 570

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir64aNP_647962.1 Periplasmic_Binding_Protein_Type_2 351..>465 CDD:304360 32/118 (27%)
Lig_chan 563..828 CDD:278489
glr-6NP_741822.2 PBP1_iGluR_non_NMDA-like 21..394 CDD:380591 24/162 (15%)
PBP2_iGluR_Kainate 409..764 CDD:270432 41/166 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.