DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir64a and Grin2d

DIOPT Version :9

Sequence 1:NP_647962.1 Gene:Ir64a / 38616 FlyBaseID:FBgn0035604 Length:859 Species:Drosophila melanogaster
Sequence 2:XP_036008580.1 Gene:Grin2d / 14814 MGIID:95823 Length:1345 Species:Mus musculus


Alignment Length:461 Identity:92/461 - (19%)
Similarity:146/461 - (31%) Gaps:159/461 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 LAQSPTSGRPNR----PGNG--PTGGFSQTPSQAQSNSEWLEGVLRMEALRQIAVVDLACGAVSR 167
            ||....||.|..    ||..  |.|.|      |..::.|.:.:.|..| ..:|||.....|:.|
Mouse   281 LAGGGGSGVPGEPLLLPGGAPLPAGLF------AVRSAGWRDDLARRVA-AGVAVVARGAQALLR 338

  Fly   168 --RFL-EL-----ASAKMLYSEKFHWLLIEDFAWHGRTQTAEGSG------------KRDD---- 208
              .|| ||     |..:....|..|...: :..|..|..:....|            .||.    
Mouse   339 DYGFLPELGHDCRAQNRTHRGESLHRYFM-NITWDNRDYSFNEDGFLVNPSLVVISLTRDRTWEV 402

  Fly   209 -GEMEEE----EPP-----GQQIQATDDEDLPSIESFLGGMNLYMNTELTLAKRMSEAAHYTLFD 263
             |..|::    :.|     |:.:|..||                 ...||:|  ..|...:.:.:
Mouse   403 VGSWEQQTLRLKYPLWSRYGRFLQPVDD-----------------TQHLTVA--TLEERPFVIVE 448

  Fly   264 VWNPGLNYGGHVNLTEIGSFTPTEGIQLHTWFRTTSTVRRRM---DMQHARVRCMVVVTNKNMTG 325
            ..:|       ::.|.|....|... ||:   ||.|.|..|.   |......||.     |....
Mouse   449 PADP-------ISGTCIRDSVPCRS-QLN---RTHSLVAPRSPPPDAPRPEKRCC-----KGFCI 497

  Fly   326 TLMYYLTHTMSGHIDTMNRFNFNLLMAVRDMFNWTFVLSRTTSWGYVKNGRFDGMIGALIRNETD 390
            .::..|.||:.                    |::...|......|...:|.::||||.:.....|
Mouse   498 DILKRLAHTIG--------------------FSYDLYLVTNGKHGKKIDGVWNGMIGEVFYQRAD 542

  Fly   391 IGGAPIFYWLERHKWID-------------VAGRSWSSRP----CFIFRHPRSTQKDRIVFLQPF 438
            :....:....||.:.:|             ||..:.:..|    .|.:..|..:.       :|:
Mouse   543 MAIGSLTINEERSEIVDFSVPFVETGISVMVARSNGTVSPSAFLAFAWLMPPMSP-------EPY 600

  Fly   439 TNDVWILI-VGC---GVLTVFILWFLTTIE-------------------------WKLVPHDGSA 474
            :..||::: |.|   ..:||||..:|:.:.                         |.||.::...
Mouse   601 SPAVWVMMFVMCLTVVAVTVFIFEYLSPVGYNRSLATGKRPGGSTFTIGKSIWLLWALVFNNSVP 665

  Fly   475 LIKPKG 480
            :..|:|
Mouse   666 VENPRG 671

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir64aNP_647962.1 Periplasmic_Binding_Protein_Type_2 351..>465 CDD:304360 27/159 (17%)
Lig_chan 563..828 CDD:278489
Grin2dXP_036008580.1 Periplasmic_Binding_Protein_type1 <156..415 CDD:415822 33/141 (23%)
PBP2_iGluR_NMDA_Nr2 432..849 CDD:270436 54/285 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846533
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.