Sequence 1: | NP_647962.1 | Gene: | Ir64a / 38616 | FlyBaseID: | FBgn0035604 | Length: | 859 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001350679.1 | Gene: | Grin2b / 14812 | MGIID: | 95821 | Length: | 1482 | Species: | Mus musculus |
Alignment Length: | 236 | Identity: | 48/236 - (20%) |
---|---|---|---|
Similarity: | 79/236 - (33%) | Gaps: | 64/236 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 280 IGSFTPTEGIQLHTWFRTTSTVRRRMDMQHARVRCMVVVTNKNMTGTLMYYLTHTMSGHIDTMNR 344
Fly 345 FNFNLLMAVRDMFNWTFVLSRTTSWGYVK--NGRFDGMIGALIRNETDIGGAPIFYWLERHKWID 407
Fly 408 VAGRSWSSRPCFIFRHPRSTQKDRIVFLQPFTNDVWI------LIVGCGVLTVF----------- 455
Fly 456 ----------------ILWFLTTIEWKLVPHDGSALIKPKG 480 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ir64a | NP_647962.1 | Periplasmic_Binding_Protein_Type_2 | 351..>465 | CDD:304360 | 28/148 (19%) |
Lig_chan | 563..828 | CDD:278489 | |||
Grin2b | NP_001350679.1 | PBP1_iGluR_NMDA_NR2 | 33..388 | CDD:380601 | |
PBP2_iGluR_NMDA_Nr2 | 403..803 | CDD:270436 | 48/236 (20%) | ||
NMDAR2_C | 840..1482 | CDD:402274 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167846441 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |