DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir64a and Grin2b

DIOPT Version :9

Sequence 1:NP_647962.1 Gene:Ir64a / 38616 FlyBaseID:FBgn0035604 Length:859 Species:Drosophila melanogaster
Sequence 2:NP_001350679.1 Gene:Grin2b / 14812 MGIID:95821 Length:1482 Species:Mus musculus


Alignment Length:236 Identity:48/236 - (20%)
Similarity:79/236 - (33%) Gaps:64/236 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   280 IGSFTPTEGIQLHTWFRTTSTVRRRMDMQHARVRCMVVVTNKNMTGTLMYYLTHTMSGHIDTMNR 344
            :.|..|..|    |..|.|             |.|...:.::|.|.....|:.....|       
Mouse   419 VESVDPLSG----TCMRNT-------------VPCQKRIISENKTDEEPGYIKKCCKG------- 459

  Fly   345 FNFNLLMAVRDMFNWTFVLSRTTSWGYVK--NGRFDGMIGALIRNETDIGGAPIFYWLERHKWID 407
            |..::|..:.....:|:.|...|:..:.|  ||.::||||.::.....:....:....||.:.:|
Mouse   460 FCIDILKKISKSVKFTYDLYLVTNGKHGKKINGTWNGMIGEVVMKRAYMAVGSLTINEERSEVVD 524

  Fly   408 VAGRSWSSRPCFIFRHPRSTQKDRIVFLQPFTNDVWI------LIVGCGVLTVF----------- 455
            .:.....:....:......|.... .||:||:.|||:      |||....:.||           
Mouse   525 FSVPFIETGISVMVSRSNGTVSPS-AFLEPFSADVWVMMFVMLLIVSAVAVFVFEYFSPVGYNRC 588

  Fly   456 ----------------ILWFLTTIEWKLVPHDGSALIKPKG 480
                            .:|.|    |.||.::...:..|||
Mouse   589 LADGREPGGPSFTIGKAIWLL----WGLVFNNSVPVQNPKG 625

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir64aNP_647962.1 Periplasmic_Binding_Protein_Type_2 351..>465 CDD:304360 28/148 (19%)
Lig_chan 563..828 CDD:278489
Grin2bNP_001350679.1 PBP1_iGluR_NMDA_NR2 33..388 CDD:380601
PBP2_iGluR_NMDA_Nr2 403..803 CDD:270436 48/236 (20%)
NMDAR2_C 840..1482 CDD:402274
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846441
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.