DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pfdn4 and GIM3

DIOPT Version :9

Sequence 1:NP_647961.1 Gene:Pfdn4 / 38615 FlyBaseID:FBgn0035603 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_014246.1 Gene:GIM3 / 855569 SGDID:S000005097 Length:129 Species:Saccharomyces cerevisiae


Alignment Length:119 Identity:47/119 - (39%)
Similarity:73/119 - (61%) Gaps:0/119 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 DDVHISFEDQQRINRFAKHNARMDDFKAELETKRNELKSLEEALEEIELFDEDEDIPFLVGEVFL 81
            ::..::|||||:||.|:|...|.|....||..:|.|.:.|::...||||.||||.:.:.||::|:
Yeast    10 NNTQVTFEDQQKINEFSKLIMRKDAIAQELSLQREEKEYLDDVSLEIELIDEDEPVQYKVGDLFI 74

  Fly    82 SHKLEKTQDMLKETKEQVLKEIAGVEAKAKVIKAEMDELKAHLYQRFGSNISLE 135
            ..|..|....|::..|::..:|..:|.|.:.|.:.:|.|||.||.:||.||:||
Yeast    75 FMKQSKVTAQLEKDAERLDNKIETLEDKQRDIDSRLDALKAILYAKFGDNINLE 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pfdn4NP_647961.1 Prefoldin_2 26..129 CDD:280154 38/102 (37%)
GIM3NP_014246.1 GimC 4..129 CDD:224300 47/119 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341374
Domainoid 1 1.000 73 1.000 Domainoid score I2194
eggNOG 1 0.900 - - E1_COG1382
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I1557
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53967
OrthoFinder 1 1.000 - - FOG0004984
OrthoInspector 1 1.000 - - oto100337
orthoMCL 1 0.900 - - OOG6_102908
Panther 1 1.100 - - LDO PTHR21100
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R907
SonicParanoid 1 1.000 - - X4059
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.