DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pfdn4 and AIP3

DIOPT Version :9

Sequence 1:NP_647961.1 Gene:Pfdn4 / 38615 FlyBaseID:FBgn0035603 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_563827.1 Gene:AIP3 / 837400 AraportID:AT1G08780 Length:129 Species:Arabidopsis thaliana


Alignment Length:120 Identity:38/120 - (31%)
Similarity:71/120 - (59%) Gaps:1/120 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 DVHISFEDQQRINRFAKHNARMDDFKAELETKRNELKSLEEALEEIELFDEDEDIPFLVGEVFLS 82
            ::.:::||||.||.|::.|.|:.|...::::.:.:.::||:|..|:.|.|| |.:.|.:||||..
plant    11 EMEVTWEDQQNINIFSRLNNRVHDLDDDIKSAKEKCENLEDAGNELILADE-EMVRFQIGEVFAH 74

  Fly    83 HKLEKTQDMLKETKEQVLKEIAGVEAKAKVIKAEMDELKAHLYQRFGSNISLEAE 137
            ...:..:..::|.||...|.:..:|.:.:.|..:|..||..||.:|..:|:||.:
plant    75 VPRDDVETKIEEMKEATCKSLEKLEQEKESIVTQMAALKKVLYAKFKDSINLEED 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pfdn4NP_647961.1 Prefoldin_2 26..129 CDD:280154 32/102 (31%)
AIP3NP_563827.1 Prefoldin_2 22..122 CDD:396482 31/100 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1382
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53967
OrthoDB 1 1.010 - - D1459797at2759
OrthoFinder 1 1.000 - - FOG0004984
OrthoInspector 1 1.000 - - oto3712
orthoMCL 1 0.900 - - OOG6_102908
Panther 1 1.100 - - LDO PTHR21100
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4059
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.790

Return to query results.
Submit another query.