DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pfdn4 and AIP3

DIOPT Version :10

Sequence 1:NP_647961.1 Gene:Pfdn4 / 38615 FlyBaseID:FBgn0035603 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_563827.1 Gene:AIP3 / 837400 AraportID:AT1G08780 Length:129 Species:Arabidopsis thaliana


Alignment Length:120 Identity:38/120 - (31%)
Similarity:71/120 - (59%) Gaps:1/120 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 DVHISFEDQQRINRFAKHNARMDDFKAELETKRNELKSLEEALEEIELFDEDEDIPFLVGEVFLS 82
            ::.:::||||.||.|::.|.|:.|...::::.:.:.::||:|..|:.|.|| |.:.|.:||||..
plant    11 EMEVTWEDQQNINIFSRLNNRVHDLDDDIKSAKEKCENLEDAGNELILADE-EMVRFQIGEVFAH 74

  Fly    83 HKLEKTQDMLKETKEQVLKEIAGVEAKAKVIKAEMDELKAHLYQRFGSNISLEAE 137
            ...:..:..::|.||...|.:..:|.:.:.|..:|..||..||.:|..:|:||.:
plant    75 VPRDDVETKIEEMKEATCKSLEKLEQEKESIVTQMAALKKVLYAKFKDSINLEED 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pfdn4NP_647961.1 Prefoldin_4 25..127 CDD:467481 33/101 (33%)
coiled coil 25..66 CDD:467481 13/40 (33%)
coiled coil 86..127 CDD:467481 11/40 (28%)
AIP3NP_563827.1 Prefoldin_4 18..119 CDD:467481 33/101 (33%)
coiled coil 18..59 CDD:467481 13/40 (33%)
coiled coil 78..119 CDD:467481 11/40 (28%)

Return to query results.
Submit another query.