DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pfdn4 and PFDN4

DIOPT Version :9

Sequence 1:NP_647961.1 Gene:Pfdn4 / 38615 FlyBaseID:FBgn0035603 Length:138 Species:Drosophila melanogaster
Sequence 2:XP_016883368.1 Gene:PFDN4 / 5203 HGNCID:8868 Length:181 Species:Homo sapiens


Alignment Length:126 Identity:55/126 - (43%)
Similarity:96/126 - (76%) Gaps:1/126 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 QNHDDVHISFEDQQRINRFAKHNARMDDFKAELETKRNELKSLEEALEEIELFDED-EDIPFLVG 77
            |..:||:::|||||:||:||::.:|:.:.|.|:|.|:.:|::||:|.::|.|.|:| ..||:.:|
Human    55 QAAEDVNVTFEDQQKINKFARNTSRITELKEEIEVKKKQLQNLEDACDDIMLADDDCLMIPYQIG 119

  Fly    78 EVFLSHKLEKTQDMLKETKEQVLKEIAGVEAKAKVIKAEMDELKAHLYQRFGSNISLEAED 138
            :||:||..|:||:||:|.|:.:.:||..:|::.:.|:..:.:||..||.:|||||:|||::
Human   120 DVFISHSQEETQEMLEEAKKNLQEEIDALESRVESIQRVLADLKVQLYAKFGSNINLEADE 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pfdn4NP_647961.1 Prefoldin_2 26..129 CDD:280154 41/103 (40%)
PFDN4XP_016883368.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141021
Domainoid 1 1.000 95 1.000 Domainoid score I7462
eggNOG 1 0.900 - - E1_COG1382
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37645
Inparanoid 1 1.050 119 1.000 Inparanoid score I4793
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53967
OrthoDB 1 1.010 - - D1459797at2759
OrthoFinder 1 1.000 - - FOG0004984
OrthoInspector 1 1.000 - - oto91717
orthoMCL 1 0.900 - - OOG6_102908
Panther 1 1.100 - - LDO PTHR21100
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R907
SonicParanoid 1 1.000 - - X4059
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.