DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pfdn4 and Pfdn6

DIOPT Version :9

Sequence 1:NP_647961.1 Gene:Pfdn4 / 38615 FlyBaseID:FBgn0035603 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_001262079.1 Gene:Pfdn6 / 40176 FlyBaseID:FBgn0036918 Length:125 Species:Drosophila melanogaster


Alignment Length:110 Identity:27/110 - (24%)
Similarity:49/110 - (44%) Gaps:26/110 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DQQRINRFAKHNARMDDF-------------KAELETKRNELKSLEEALEEIELFDEDEDIPFLV 76
            |::....:.|..|.::.:             :|.||::.||.|.:   |:|:.|...|..:..|.
  Fly     2 DKKSAALYKKMQAEIESYQNLQKSCLKMVKQRAVLESQLNENKCV---LDELNLLGPDNKVYKLF 63

  Fly    77 GEVFLSHKLEKTQDMLKETKEQVLKEIAGVEAKAKVIKAEMDELK 121
            |.|.:..:||       |:::.|.|.|   |..:|.:|:..|.|:
  Fly    64 GPVLVKQELE-------ESRQNVGKRI---EYISKELKSSTDALE 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pfdn4NP_647961.1 Prefoldin_2 26..129 CDD:280154 26/109 (24%)
Pfdn6NP_001262079.1 Prefoldin_beta 12..116 CDD:238345 25/100 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1382
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.