DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pfdn4 and SPAC227.05

DIOPT Version :9

Sequence 1:NP_647961.1 Gene:Pfdn4 / 38615 FlyBaseID:FBgn0035603 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_592959.1 Gene:SPAC227.05 / 2542066 PomBaseID:SPAC227.05 Length:123 Species:Schizosaccharomyces pombe


Alignment Length:122 Identity:34/122 - (27%)
Similarity:69/122 - (56%) Gaps:3/122 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 DDVHISFEDQQRINRFAKHNARMDDFKAELETKRNELKSLEEALEEIELFDED--EDIPFL-VGE 78
            :.|.:..|||:.:|.|:..::|....:.:::..:.:::.:.:|..|.||.|||  :|||.| ||:
pombe     2 EQVPVLAEDQRNLNEFSVLHSRKAIQELDIKNLKTQIEDIVDAKNECELLDEDDGDDIPALKVGD 66

  Fly    79 VFLSHKLEKTQDMLKETKEQVLKEIAGVEAKAKVIKAEMDELKAHLYQRFGSNISLE 135
            .|....|....|.|::::|.:.|::..:.:..:..:..:.|||:.||.:|...|:|:
pombe    67 AFFQVSLPVLLDQLEQSEESLEKQVDVLRSSMEKDETRIQELKSMLYSKFHDQINLD 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pfdn4NP_647961.1 Prefoldin_2 26..129 CDD:280154 28/105 (27%)
SPAC227.05NP_592959.1 GimC 1..123 CDD:224300 33/120 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1382
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53967
OrthoFinder 1 1.000 - - FOG0004984
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102908
Panther 1 1.100 - - LDO PTHR21100
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R907
SonicParanoid 1 1.000 - - X4059
TreeFam 1 0.960 - -
109.810

Return to query results.
Submit another query.