DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pfdn4 and pfd-4

DIOPT Version :9

Sequence 1:NP_647961.1 Gene:Pfdn4 / 38615 FlyBaseID:FBgn0035603 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_502128.1 Gene:pfd-4 / 178045 WormBaseID:WBGene00007107 Length:126 Species:Caenorhabditis elegans


Alignment Length:124 Identity:41/124 - (33%)
Similarity:68/124 - (54%) Gaps:10/124 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ISFEDQQRINRFAKHNARMDDFKAELETKRNELKSLEEALEEIELFDEDED---IPFLVGEVFLS 82
            :|.|||..:|:||:........||:::..:..:.::.||.:||.|.| |||   ||..:|..|:.
 Worm     7 VSAEDQALLNKFARSYQTQTQLKADVKEAKTLIDNINEASDEILLLD-DEDSASIPCRIGSCFVH 70

  Fly    83 HKLEKTQDML---KETKEQVLKEIAGVEAKAKVIKAEMDELKAHLYQRFGSNISLEAED 138
            ...:...:.|   |.|.|:||.|   ..::...|.|:|:::|..||.:||..|:|:||:
 Worm    71 FNGDSLNEHLEGKKTTAEKVLSE---KTSELDAISADMEQIKKVLYAKFGDQINLDAEE 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pfdn4NP_647961.1 Prefoldin_2 26..129 CDD:280154 32/108 (30%)
pfd-4NP_502128.1 Prefoldin_2 12..117 CDD:280154 32/108 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156241
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1382
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 64 1.000 Inparanoid score I3967
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53967
OrthoDB 1 1.010 - - D1459797at2759
OrthoFinder 1 1.000 - - FOG0004984
OrthoInspector 1 1.000 - - oto17860
orthoMCL 1 0.900 - - OOG6_102908
Panther 1 1.100 - - LDO PTHR21100
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R907
SonicParanoid 1 1.000 - - X4059
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1312.840

Return to query results.
Submit another query.