DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pfdn4 and Pfdn4

DIOPT Version :9

Sequence 1:NP_647961.1 Gene:Pfdn4 / 38615 FlyBaseID:FBgn0035603 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_001103622.1 Gene:Pfdn4 / 109054 MGIID:1923512 Length:134 Species:Mus musculus


Alignment Length:123 Identity:53/123 - (43%)
Similarity:93/123 - (75%) Gaps:1/123 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 DDVHISFEDQQRINRFAKHNARMDDFKAELETKRNELKSLEEALEEIELFDED-EDIPFLVGEVF 80
            :||:::|||||:||:||::.:|:.:.|.|:|.|:..|::||:|.::|.|.|:| ..||:.:|:||
Mouse    11 EDVNVTFEDQQKINKFARNTSRITELKEEIEVKKKHLQNLEDACDDIMLADDDCLMIPYQIGDVF 75

  Fly    81 LSHKLEKTQDMLKETKEQVLKEIAGVEAKAKVIKAEMDELKAHLYQRFGSNISLEAED 138
            :||..|:||:||::.|:.:.:||..:|::...|:..:.:||..||.:|||||:|||::
Mouse    76 ISHSQEETQEMLEDAKKTLQEEIDALESRVASIQRVLADLKVQLYAKFGSNINLEADE 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pfdn4NP_647961.1 Prefoldin_2 26..129 CDD:280154 40/103 (39%)
Pfdn4NP_001103622.1 Prefoldin_2 23..125 CDD:396482 40/102 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830975
Domainoid 1 1.000 92 1.000 Domainoid score I7608
eggNOG 1 0.900 - - E1_COG1382
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37645
Inparanoid 1 1.050 116 1.000 Inparanoid score I4808
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53967
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004984
OrthoInspector 1 1.000 - - oto95300
orthoMCL 1 0.900 - - OOG6_102908
Panther 1 1.100 - - LDO PTHR21100
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R907
SonicParanoid 1 1.000 - - X4059
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.