DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pfdn4 and Pfdn4

DIOPT Version :9

Sequence 1:NP_647961.1 Gene:Pfdn4 / 38615 FlyBaseID:FBgn0035603 Length:138 Species:Drosophila melanogaster
Sequence 2:XP_003749684.2 Gene:Pfdn4 / 100366237 RGDID:2324021 Length:132 Species:Rattus norvegicus


Alignment Length:106 Identity:42/106 - (39%)
Similarity:77/106 - (72%) Gaps:3/106 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AKVASGTNKVFQNHDDVHISFEDQQRINRFAKHNARMDDFKAELETKRNELKSLEEALEEIELFD 67
            :|:|:...|...  :||:::|||||:||:||::.:|:.:.|.|:|.|:..|::||:|.:::.|.|
  Rat     4 SKMAATMKKAAA--EDVNVTFEDQQKINKFARNTSRITELKEEIEVKKKHLQNLEDACDDVMLAD 66

  Fly    68 ED-EDIPFLVGEVFLSHKLEKTQDMLKETKEQVLKEIAGVE 107
            :| ..||:.:|:||:||..|:||:||::.|:.:.:||..:|
  Rat    67 DDCLMIPYQIGDVFISHSQEETQEMLEDAKKTLQEEIIALE 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pfdn4NP_647961.1 Prefoldin_2 26..129 CDD:280154 34/83 (41%)
Pfdn4XP_003749684.2 Prefoldin_2 28..>107 CDD:396482 32/79 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334687
Domainoid 1 1.000 91 1.000 Domainoid score I7570
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37645
Inparanoid 1 1.050 117 1.000 Inparanoid score I4714
OMA 1 1.010 - - QHG53967
OrthoDB 1 1.010 - - D1459797at2759
OrthoFinder 1 1.000 - - FOG0004984
OrthoInspector 1 1.000 - - oto98784
orthoMCL 1 0.900 - - OOG6_102908
Panther 1 1.100 - - LDO PTHR21100
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4059
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.910

Return to query results.
Submit another query.