DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pfdn4 and pfdn4

DIOPT Version :9

Sequence 1:NP_647961.1 Gene:Pfdn4 / 38615 FlyBaseID:FBgn0035603 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_001163965.1 Gene:pfdn4 / 100038150 XenbaseID:XB-GENE-856231 Length:129 Species:Xenopus tropicalis


Alignment Length:122 Identity:48/122 - (39%)
Similarity:92/122 - (75%) Gaps:0/122 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 DDVHISFEDQQRINRFAKHNARMDDFKAELETKRNELKSLEEALEEIELFDEDEDIPFLVGEVFL 81
            :||:::|||||:||.||::..|:.:.|.|:|.|:.:|::||:|.|::.:.::...:|:.:|:||:
 Frog     7 EDVNVTFEDQQKINIFARNTNRVTELKDEIEVKKKQLQNLEDACEDLMMLEDSLLVPYQIGDVFI 71

  Fly    82 SHKLEKTQDMLKETKEQVLKEIAGVEAKAKVIKAEMDELKAHLYQRFGSNISLEAED 138
            ||..|:||:||:..|:|:.:||..::::.:.|:..:.:||..||.:||:||:|||::
 Frog    72 SHSQEETQEMLEAAKKQLEEEIECLQSRIESIQQVLSDLKVQLYAKFGNNINLEADE 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pfdn4NP_647961.1 Prefoldin_2 26..129 CDD:280154 36/102 (35%)
pfdn4NP_001163965.1 Prefoldin_2 16..119 CDD:280154 36/102 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 88 1.000 Domainoid score I7826
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H37645
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459797at2759
OrthoFinder 1 1.000 - - FOG0004984
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR21100
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R907
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.140

Return to query results.
Submit another query.