DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Membrin and GOSR2

DIOPT Version :9

Sequence 1:NP_647960.1 Gene:Membrin / 38614 FlyBaseID:FBgn0260856 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001308062.1 Gene:GOSR2 / 9570 HGNCID:4431 Length:257 Species:Homo sapiens


Alignment Length:197 Identity:83/197 - (42%)
Similarity:123/197 - (62%) Gaps:3/197 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MESLYHQTNNVVKDIERDFQRLSQLSAQESLDVENGIQLKITQANANCDRLDVLLYKVPPSQRQS 65
            |:.|:.||:..|.:|:....||.....|....|||.||..|.|..:..:||::|..|.||::||:
Human     1 MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQN 65

  Fly    66 SKLRVDQLKYDLRHLQTSLQTARERRQRRMQEISEREQLLNHRFTANSAQPEETRLQLDYELQHH 130
            ::|||||||||::||||:|:..:.||..|.|:..:||:||:..||.|.:   :|.:.:|..||.:
Human    66 ARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDS---DTTIPMDESLQFN 127

  Fly   131 TQLGNAHRGVDDMIASGSGILESLISQRMTLGGAHKRIQAIGSTLGLSNHTMKLIERRLVEDRRI 195
            :.|...|.|:||:|..|..||:.|.:||:||.|..|:|..|.:.|||||..|:|||:|..:|:..
Human   128 SSLQKVHNGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYF 192

  Fly   196 FI 197
            .|
Human   193 MI 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MembrinNP_647960.1 SNARE_GS27 124..188 CDD:277216 30/63 (48%)
GOSR2NP_001308062.1 IxM motif, signal for cargo packaging into COPII-coated vesicles. /evidence=ECO:0000269|PubMed:18843296 118..120 0/1 (0%)
SNARE_GS27 120..185 CDD:277216 30/64 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 95 1.000 Domainoid score I7461
eggNOG 1 0.900 - - E1_KOG3251
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37907
Inparanoid 1 1.050 169 1.000 Inparanoid score I4146
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55230
OrthoDB 1 1.010 - - D1139640at2759
OrthoFinder 1 1.000 - - FOG0003803
OrthoInspector 1 1.000 - - oto91262
orthoMCL 1 0.900 - - OOG6_102735
Panther 1 1.100 - - LDO PTHR21230
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4591
SonicParanoid 1 1.000 - - X4845
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.870

Return to query results.
Submit another query.