DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Membrin and BOS1

DIOPT Version :9

Sequence 1:NP_647960.1 Gene:Membrin / 38614 FlyBaseID:FBgn0260856 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_013179.1 Gene:BOS1 / 850767 SGDID:S000004068 Length:244 Species:Saccharomyces cerevisiae


Alignment Length:258 Identity:50/258 - (19%)
Similarity:94/258 - (36%) Gaps:61/258 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MESLYHQTNNVVKDIERDFQRLSQLSAQESLDVENGIQLKIT----------------QANANCD 49
            |.:||:........::::..|..:.|....:.::..|...:.                :.:.|.:
Yeast     1 MNALYNHAVKQKNQLQQELARFEKNSVTAPISLQGSISATLVSLEKTVKQYAEHLNRYKEDTNAE 65

  Fly    50 RLDVLLYKVPPSQRQSSKLRVDQLKY-----DLRHLQTSLQTARERRQRRM-------------Q 96
            .:|      |....:.:.|..|...:     ||:      |:..|...|..             .
Yeast    66 EID------PKFANRLATLTQDLHDFTAKFKDLK------QSYNENNSRTQLFGSGASHVMDSDN 118

  Fly    97 EISEREQLLNHR----FTANSAQPEET--RLQLDYELQHHTQL---GNAHRGVDDMIASGSGILE 152
            ..|..|.::|.|    .:||..:....  .|.|...||....:   |||.  :|.::..|....|
Yeast   119 PFSTSETIMNKRNVGGASANGKEGSSNGGGLPLYQGLQKEQSVFERGNAQ--LDYILEMGQQSFE 181

  Fly   153 SLISQRMTLGGAHKRIQAIGSTLGLSNHTMKLIERRLVEDRRIFIGGVVVTLLIIALIIYFLV 215
            :::.|...|.....|:.....|||:|..|:..|.:|:.:|:.:|  .:.:.||||.  ||:::
Yeast   182 NIVEQNKILSKVQDRMSNGLRTLGVSEQTITSINKRVFKDKLVF--WIALILLIIG--IYYVL 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MembrinNP_647960.1 SNARE_GS27 124..188 CDD:277216 17/66 (26%)
BOS1NP_013179.1 SNARE_GS27 152..217 CDD:277216 17/66 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3251
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003803
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102735
Panther 1 1.100 - - LDO PTHR21230
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4591
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.