DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Membrin and MEMB11

DIOPT Version :9

Sequence 1:NP_647960.1 Gene:Membrin / 38614 FlyBaseID:FBgn0260856 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001154560.1 Gene:MEMB11 / 818264 AraportID:AT2G36900 Length:225 Species:Arabidopsis thaliana


Alignment Length:192 Identity:55/192 - (28%)
Similarity:95/192 - (49%) Gaps:9/192 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MESLYHQTNNVVKDIERDFQRLSQL--SAQESLDVENGIQLKITQANANCDRLDVLLYKVP-PSQ 62
            :..:|.....::.......:||.:.  |:.:|.|:.:.::..||:..:.|..:|.|...:| .||
plant    12 LSDVYSSAKRILLKARDGIERLERFESSSMDSPDLASSVKRDITEVRSLCSNMDTLWRSIPVKSQ 76

  Fly    63 RQSSKLRVDQLKYDLRHLQTSLQTARERRQRRMQEISEREQLLNHRFTANSAQPEETRLQL-DYE 126
            |...:.:.:|:..:..:|..||:....|.||:|.|..||..||. |.:...|.    .||: |.|
plant    77 RDLWRRKTEQVGEEAEYLNLSLEKYMSRNQRKMLEAKERADLLG-RASGEGAH----ILQIFDEE 136

  Fly   127 LQHHTQLGNAHRGVDDMIASGSGILESLISQRMTLGGAHKRIQAIGSTLGLSNHTMKLIERR 188
            .|..:.:.|:.|.:::..:||..||.....||..|..|.::...:.:|:||||..::|||||
plant   137 AQAMSSVKNSKRMLEESFSSGVAILSKYAEQRDRLKSAQRKALDVLNTVGLSNSVLRLIERR 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MembrinNP_647960.1 SNARE_GS27 124..188 CDD:277216 21/63 (33%)
MEMB11NP_001154560.1 SNARE_GS27 133..198 CDD:277216 21/64 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 43 1.000 Domainoid score I4747
eggNOG 1 0.900 - - E1_KOG3251
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 88 1.000 Inparanoid score I2304
OMA 1 1.010 - - QHG55230
OrthoDB 1 1.010 - - D1139640at2759
OrthoFinder 1 1.000 - - FOG0003803
OrthoInspector 1 1.000 - - otm2626
orthoMCL 1 0.900 - - OOG6_102735
Panther 1 1.100 - - O PTHR21230
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.840

Return to query results.
Submit another query.