DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Membrin and Gosr2

DIOPT Version :9

Sequence 1:NP_647960.1 Gene:Membrin / 38614 FlyBaseID:FBgn0260856 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_062624.2 Gene:Gosr2 / 56494 MGIID:1927204 Length:212 Species:Mus musculus


Alignment Length:214 Identity:93/214 - (43%)
Similarity:140/214 - (65%) Gaps:3/214 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MESLYHQTNNVVKDIERDFQRLSQLSAQESLDVENGIQLKITQANANCDRLDVLLYKVPPSQRQS 65
            ||.||.|||..|::|:....||.:...|....|||.||..|.|..::.:||::|..|.|.::||:
Mouse     1 MEPLYQQTNKQVQEIQSHMGRLERADKQSVHLVENEIQASIEQIFSHLERLEILSSKEPLNRRQN 65

  Fly    66 SKLRVDQLKYDLRHLQTSLQTARERRQRRMQEISEREQLLNHRFTANSAQPEETRLQLDYELQHH 130
            :||||||||||::||||:|:..:.|||.|.|:..:|::||:..||.|.:   :|.:.:|..||.:
Mouse    66 AKLRVDQLKYDVQHLQTALRNFQHRRQVREQQERQRDELLSRTFTTNDS---DTTIPMDESLQFN 127

  Fly   131 TQLGNAHRGVDDMIASGSGILESLISQRMTLGGAHKRIQAIGSTLGLSNHTMKLIERRLVEDRRI 195
            :.|.|.|.|:||:|..|..|||.|.:||:||.|..|:|..|.:.|||||..|:|||:|..:|:..
Mouse   128 SSLHNIHHGMDDLIGGGHSILEGLRAQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYF 192

  Fly   196 FIGGVVVTLLIIALIIYFL 214
            .|||:::|..::.|::.:|
Mouse   193 MIGGMLLTCAVMFLVVQYL 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MembrinNP_647960.1 SNARE_GS27 124..188 CDD:277216 32/63 (51%)
Gosr2NP_062624.2 DUF3084 <7..>107 CDD:331293 45/99 (45%)
IxM motif, signal for cargo packaging into COPII-coated vesicles. /evidence=ECO:0000250|UniProtKB:O14653 118..120 0/1 (0%)
SNARE_GS27 120..185 CDD:277216 32/64 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 99 1.000 Domainoid score I7128
eggNOG 1 0.900 - - E1_KOG3251
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37907
Inparanoid 1 1.050 176 1.000 Inparanoid score I4049
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55230
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003803
OrthoInspector 1 1.000 - - oto94843
orthoMCL 1 0.900 - - OOG6_102735
Panther 1 1.100 - - LDO PTHR21230
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4591
SonicParanoid 1 1.000 - - X4845
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.860

Return to query results.
Submit another query.