DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Membrin and Vti1a

DIOPT Version :9

Sequence 1:NP_647960.1 Gene:Membrin / 38614 FlyBaseID:FBgn0260856 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_612053.1 Gene:Vti1a / 38085 FlyBaseID:FBgn0260862 Length:230 Species:Drosophila melanogaster


Alignment Length:233 Identity:49/233 - (21%)
Similarity:103/233 - (44%) Gaps:40/233 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MESLYHQTNNVVKDIERDFQRLSQL-SAQESLDVENGIQLKITQANANCDRLDVLLYKVPPSQRQ 64
            :|....|...::.:|.....||.|. :..|..|:.:.|...:.:|....:::.:.:.::.|..|.
  Fly     4 LEQYEQQYATLIAEITAHIGRLQQQNNNSERHDLCSKIDSSLPEAQELLEQMGLEVRELNPGLRS 68

  Fly    65 S--SKLRVDQLKYDLRHLQTSLQTARERRQRR------------MQEIS----EREQLLNHRFTA 111
            |  .||:|.|.  :|:.||...:..:::::.:            .:::|    :|::||:     
  Fly    69 SFNGKLQVAQA--ELKRLQAEYRLTKDKQRSQANTFTTLDLGDSYEDVSISTDQRQRLLD----- 126

  Fly   112 NSAQPEET--RLQLDYELQHHTQLGNAHRGVDDMIASGSGILESLISQRMTLGGAHKRIQAIGST 174
            ||.:.|.|  ||...|.:...|:            ..|:.:|..|..||.||.||..|::...:.
  Fly   127 NSERIERTGNRLTEGYRVALETE------------QLGAQVLNDLHHQRETLQGARARLRETNAE 179

  Fly   175 LGLSNHTMKLIERRLVEDRRIFIGGVVVTLLIIALIIY 212
            ||.::.|:..:..|.:.::.:..|..|..::.:.:.:|
  Fly   180 LGRASRTLNTMMLRALREKVVLYGVGVCFVVAVGVSLY 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MembrinNP_647960.1 SNARE_GS27 124..188 CDD:277216 15/63 (24%)
Vti1aNP_612053.1 V-SNARE 11..89 CDD:282816 18/79 (23%)
SNARE_Vti1a 128..189 CDD:277244 20/72 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21230
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.