DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Membrin and gosr2

DIOPT Version :9

Sequence 1:NP_647960.1 Gene:Membrin / 38614 FlyBaseID:FBgn0260856 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_955982.1 Gene:gosr2 / 324569 ZFINID:ZDB-GENE-030131-3290 Length:212 Species:Danio rerio


Alignment Length:214 Identity:91/214 - (42%)
Similarity:141/214 - (65%) Gaps:3/214 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MESLYHQTNNVVKDIERDFQRLSQLSAQESLDVENGIQLKITQANANCDRLDVLLYKVPPSQRQS 65
            ||:||||||..:::::....||.:...|....:||.:|.:|.|.....:||::|..|.||::||:
Zfish     1 METLYHQTNKQIQEVQSQMGRLEKTDRQSVHLLENELQARIDQIFNQLERLEILASKEPPNRRQN 65

  Fly    66 SKLRVDQLKYDLRHLQTSLQTARERRQRRMQEISEREQLLNHRFTANSAQPEETRLQLDYELQHH 130
            :||||||||||::||||:|:..:.||.....:..|||:||:..||.|.|   :|.:.:|..||.:
Zfish    66 AKLRVDQLKYDVQHLQTALRNFQHRRYAHEAQEREREELLSRSFTTNDA---DTSIPIDETLQFN 127

  Fly   131 TQLGNAHRGVDDMIASGSGILESLISQRMTLGGAHKRIQAIGSTLGLSNHTMKLIERRLVEDRRI 195
            :.|.|||||:||::.|||.||..|..||.||.|.||::..:.:.|||||..|:|||:|..:|:.|
Zfish   128 SSLQNAHRGMDDLLGSGSSILNGLRDQRSTLKGTHKKMLDVANMLGLSNTVMRLIEKRASQDKFI 192

  Fly   196 FIGGVVVTLLIIALIIYFL 214
            .:.|::.|.:::.|::.:|
Zfish   193 MMAGMLATCVVMFLVVKYL 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MembrinNP_647960.1 SNARE_GS27 124..188 CDD:277216 33/63 (52%)
gosr2NP_955982.1 SNARE_GS27 120..185 CDD:277216 33/64 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I6853
eggNOG 1 0.900 - - E1_KOG3251
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37907
Inparanoid 1 1.050 180 1.000 Inparanoid score I3997
OMA 1 1.010 - - QHG55230
OrthoDB 1 1.010 - - D1139640at2759
OrthoFinder 1 1.000 - - FOG0003803
OrthoInspector 1 1.000 - - oto41648
orthoMCL 1 0.900 - - OOG6_102735
Panther 1 1.100 - - LDO PTHR21230
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4591
SonicParanoid 1 1.000 - - X4845
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.870

Return to query results.
Submit another query.