DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Membrin and bos1

DIOPT Version :9

Sequence 1:NP_647960.1 Gene:Membrin / 38614 FlyBaseID:FBgn0260856 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_593539.1 Gene:bos1 / 2541965 PomBaseID:SPAP14E8.03 Length:235 Species:Schizosaccharomyces pombe


Alignment Length:235 Identity:58/235 - (24%)
Similarity:108/235 - (45%) Gaps:27/235 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SLYHQTNNVVKDIERDFQRLSQLSAQESLDVE-NGIQLKITQA----NANCDRLDVLLYK-VPPS 61
            :||:....:.:.|:|....|.:....||..:. .|||.:|:.:    :.:.|..|.::.: :.|:
pombe     4 TLYNHCTKLFQSIQRSLDELERGVQDESNTISLAGIQGQISASFLSLSRSIDDYDSMVQRELVPA 68

  Fly    62 QRQSSKLRVDQLKYDLRHLQTSLQTARERRQ--RRMQEISEREQLLNHRFTANSAQ--------- 115
            :::.:.:|:.:.:.  :|:|. |:...|.:.  |.:.:...|::||..|...||..         
pombe    69 KKKKATIRIQEFRQ--KHVQL-LEKFDELKAHVRDIAQAKNRKELLGRRGYVNSLDSPYGNSTTD 130

  Fly   116 ------PEETRLQLDYELQHHTQLGNAHRGVDDMIASGSGILESLISQRMTLGGAHKRIQAIGST 174
                  |.:...| |..|:.|..||.|...||:.:..|..||..|:.|...|.....::....:|
pombe   131 AEIVEGPSDLSRQ-DGLLKEHDFLGRAESQVDEFLERGRMILGDLVEQGSVLKATKTKVLNAANT 194

  Fly   175 LGLSNHTMKLIERRLVEDRRIFIGGVVVTLLIIALIIYFL 214
            ||::.||:.||.||..:|:.||..|..:..::..||..:|
pombe   195 LGITRHTLSLINRRSKQDKIIFYCGAFLVFVLFYLIYRWL 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MembrinNP_647960.1 SNARE_GS27 124..188 CDD:277216 21/63 (33%)
bos1NP_593539.1 SNARE_GS27 143..208 CDD:277216 22/65 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 44 1.000 Domainoid score I3607
eggNOG 1 0.900 - - E1_KOG3251
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 64 1.000 Inparanoid score I1974
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003803
OrthoInspector 1 1.000 - - oto101905
orthoMCL 1 0.900 - - OOG6_102735
Panther 1 1.100 - - LDO PTHR21230
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4591
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.850

Return to query results.
Submit another query.