DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uev1A and MMS2

DIOPT Version :9

Sequence 1:NP_001286940.1 Gene:Uev1A / 38613 FlyBaseID:FBgn0035601 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_011428.1 Gene:MMS2 / 852793 SGDID:S000003055 Length:137 Species:Saccharomyces cerevisiae


Alignment Length:135 Identity:66/135 - (48%)
Similarity:89/135 - (65%) Gaps:1/135 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VPRNFRLLEELDQGQKGVGDGTISWGLENDDDMTLTYWIGMIIGPPRTPFENRMYSLKIECGERY 75
            |||||||||||::|:||.|..:.|:||.:.||:|:|.|.|.|:|||.:..|||:|||.|:||..|
Yeast     4 VPRNFRLLEELEKGEKGFGPESCSYGLADSDDITMTKWNGTILGPPHSNHENRIYSLSIDCGPNY 68

  Fly    76 PDEPPTLRFITKVNINCINQNNGVVDHRSVQMLARWSREYNIKTMLQEIRRIMTMKENLKLAQPP 140
            ||.||.:.||:|:|:.|:|...|.| ......|..|.|.|.::|:|.::|:.|....|.||.||.
Yeast    69 PDSPPKVTFISKINLPCVNPTTGEV-QTDFHTLRDWKRAYTMETLLLDLRKEMATPANKKLRQPK 132

  Fly   141 EGSCF 145
            ||..|
Yeast   133 EGETF 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uev1ANP_001286940.1 UBCc 16..142 CDD:214562 58/125 (46%)
MMS2NP_011428.1 COG5078 1..137 CDD:227410 65/133 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 95 1.000 Domainoid score I1667
eggNOG 1 0.900 - - E1_KOG0896
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I1173
Isobase 1 0.950 - 0 Normalized mean entropy S314
OMA 1 1.010 - - QHG54124
OrthoFinder 1 1.000 - - FOG0001338
OrthoInspector 1 1.000 - - oto100099
orthoMCL 1 0.900 - - OOG6_101344
Panther 1 1.100 - - LDO PTHR24068
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2190
SonicParanoid 1 1.000 - - X939
TreeFam 1 0.960 - -
1413.810

Return to query results.
Submit another query.