DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uev1A and AT1G70650

DIOPT Version :9

Sequence 1:NP_001286940.1 Gene:Uev1A / 38613 FlyBaseID:FBgn0035601 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_001185364.1 Gene:AT1G70650 / 843402 AraportID:AT1G70650 Length:595 Species:Arabidopsis thaliana


Alignment Length:135 Identity:63/135 - (46%)
Similarity:101/135 - (74%) Gaps:0/135 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VVVPRNFRLLEELDQGQKGVGDGTISWGLENDDDMTLTYWIGMIIGPPRTPFENRMYSLKIECGE 73
            ::|||||||||||::|:||:||||:|:|:::.||:.:..|.|.|:||..|.:|.:::.||:.||:
plant   444 LLVPRNFRLLEELERGEKGIGDGTVSYGMDDADDILMQSWTGTILGPHNTAYEGKIFQLKLFCGK 508

  Fly    74 RYPDEPPTLRFITKVNINCINQNNGVVDHRSVQMLARWSREYNIKTMLQEIRRIMTMKENLKLAQ 138
            .||:.|||:||.:::|:.|:|..|||||.....||:.|.||:.::.:|.::::.|...:|.||||
plant   509 DYPESPPTVRFQSRINMACVNPENGVVDPSHFPMLSNWRREFTMEDLLIQLKKEMMSSQNRKLAQ 573

  Fly   139 PPEGS 143
            |.||:
plant   574 PLEGN 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uev1ANP_001286940.1 UBCc 16..142 CDD:214562 56/125 (45%)
AT1G70650NP_001185364.1 ZnF_RBZ 236..258 CDD:197784
RanBP2-type Zn finger 238..257 CDD:275375
zf-RanBP 279..303 CDD:395516
RanBP2-type Zn finger 283..302 CDD:275375
ZnF_RBZ 314..337 CDD:197784
RanBP2-type Zn finger 316..335 CDD:275375
RanBP2-type Zn finger 358..377 CDD:275375
UBCc 451..586 CDD:214562 58/128 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2616
eggNOG 1 0.900 - - E1_KOG0896
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001338
OrthoInspector 1 1.000 - - otm2902
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.770

Return to query results.
Submit another query.