DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uev1A and AT1G70650

DIOPT Version :10

Sequence 1:NP_647959.1 Gene:Uev1A / 38613 FlyBaseID:FBgn0035601 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_001185364.1 Gene:AT1G70650 / 843402 AraportID:AT1G70650 Length:595 Species:Arabidopsis thaliana


Alignment Length:135 Identity:63/135 - (46%)
Similarity:101/135 - (74%) Gaps:0/135 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VVVPRNFRLLEELDQGQKGVGDGTISWGLENDDDMTLTYWIGMIIGPPRTPFENRMYSLKIECGE 73
            ::|||||||||||::|:||:||||:|:|:::.||:.:..|.|.|:||..|.:|.:::.||:.||:
plant   444 LLVPRNFRLLEELERGEKGIGDGTVSYGMDDADDILMQSWTGTILGPHNTAYEGKIFQLKLFCGK 508

  Fly    74 RYPDEPPTLRFITKVNINCINQNNGVVDHRSVQMLARWSREYNIKTMLQEIRRIMTMKENLKLAQ 138
            .||:.|||:||.:::|:.|:|..|||||.....||:.|.||:.::.:|.::::.|...:|.||||
plant   509 DYPESPPTVRFQSRINMACVNPENGVVDPSHFPMLSNWRREFTMEDLLIQLKKEMMSSQNRKLAQ 573

  Fly   139 PPEGS 143
            |.||:
plant   574 PLEGN 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uev1ANP_647959.1 UEV_UBE2V 9..142 CDD:467427 61/132 (46%)
AT1G70650NP_001185364.1 ZnF_RBZ 236..258 CDD:197784
RanBP2-type Zn finger 238..257 CDD:275375
zf-RanBP 279..303 CDD:395516
RanBP2-type Zn finger 283..302 CDD:275375
ZnF_RBZ 314..337 CDD:197784
RanBP2-type Zn finger 316..335 CDD:275375
RanBP2-type Zn finger 358..377 CDD:275375
UEV_UBE2V 446..577 CDD:467427 61/130 (47%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.