DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uev1A and MMZ1

DIOPT Version :9

Sequence 1:NP_001286940.1 Gene:Uev1A / 38613 FlyBaseID:FBgn0035601 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_564191.1 Gene:MMZ1 / 838935 AraportID:AT1G23260 Length:158 Species:Arabidopsis thaliana


Alignment Length:135 Identity:67/135 - (49%)
Similarity:100/135 - (74%) Gaps:0/135 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VVVPRNFRLLEELDQGQKGVGDGTISWGLENDDDMTLTYWIGMIIGPPRTPFENRMYSLKIECGE 73
            |||||||||||||::|:||:||||:|:|:::.||:.:..|.|.|:|||.|.:|.:::.||:.||:
plant     8 VVVPRNFRLLEELERGEKGIGDGTVSYGMDDADDIYMQSWTGTILGPPNTAYEGKIFQLKLFCGK 72

  Fly    74 RYPDEPPTLRFITKVNINCINQNNGVVDHRSVQMLARWSREYNIKTMLQEIRRIMTMKENLKLAQ 138
            .||:.|||:||.|::|:.|:|...|||:.....||..|.|||.::.:|.::::.|....|.||||
plant    73 EYPESPPTVRFQTRINMACVNPETGVVEPSLFPMLTNWRREYTMEDILVKLKKEMMTSHNRKLAQ 137

  Fly   139 PPEGS 143
            ||||:
plant   138 PPEGN 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uev1ANP_001286940.1 UBCc 16..142 CDD:214562 58/125 (46%)
MMZ1NP_564191.1 UBCc 15..150 CDD:214562 60/128 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2616
eggNOG 1 0.900 - - E1_KOG0896
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 164 1.000 Inparanoid score I1602
OMA 1 1.010 - - QHG54124
OrthoDB 1 1.010 - - D1507995at2759
OrthoFinder 1 1.000 - - FOG0001338
OrthoInspector 1 1.000 - - otm2902
orthoMCL 1 0.900 - - OOG6_101344
Panther 1 1.100 - - O PTHR24068
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X939
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.