DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uev1A and UBE2V2

DIOPT Version :9

Sequence 1:NP_001286940.1 Gene:Uev1A / 38613 FlyBaseID:FBgn0035601 Length:145 Species:Drosophila melanogaster
Sequence 2:XP_011515885.1 Gene:UBE2V2 / 7336 HGNCID:12495 Length:173 Species:Homo sapiens


Alignment Length:138 Identity:92/138 - (66%)
Similarity:119/138 - (86%) Gaps:0/138 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GVVVPRNFRLLEELDQGQKGVGDGTISWGLENDDDMTLTYWIGMIIGPPRTPFENRMYSLKIECG 72
            ||.|||||||||||::|||||||||:|||||:|:|||||.|.|||||||||.:|||:||||:|||
Human    34 GVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECG 98

  Fly    73 ERYPDEPPTLRFITKVNINCINQNNGVVDHRSVQMLARWSREYNIKTMLQEIRRIMTMKENLKLA 137
            .:||:.||::||:||:|:|.||.::|:||.||:.:||:|...|:||.:|||:||:|..|||:||.
Human    99 PKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLP 163

  Fly   138 QPPEGSCF 145
            |||||..:
Human   164 QPPEGQTY 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uev1ANP_001286940.1 UBCc 16..142 CDD:214562 83/125 (66%)
UBE2V2XP_011515885.1 UBCc 42..173 CDD:214562 85/130 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158331
Domainoid 1 1.000 142 1.000 Domainoid score I4690
eggNOG 1 0.900 - - E1_KOG0896
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 222 1.000 Inparanoid score I3543
Isobase 1 0.950 - 0 Normalized mean entropy S314
OMA 1 1.010 - - QHG54124
OrthoDB 1 1.010 - - D1507995at2759
OrthoFinder 1 1.000 - - FOG0001338
OrthoInspector 1 1.000 - - otm41945
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24068
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2190
SonicParanoid 1 1.000 - - X939
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.850

Return to query results.
Submit another query.