DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uev1A and UBE2V1

DIOPT Version :9

Sequence 1:NP_001286940.1 Gene:Uev1A / 38613 FlyBaseID:FBgn0035601 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_001244322.1 Gene:UBE2V1 / 7335 HGNCID:12494 Length:170 Species:Homo sapiens


Alignment Length:138 Identity:94/138 - (68%)
Similarity:119/138 - (86%) Gaps:0/138 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GVVVPRNFRLLEELDQGQKGVGDGTISWGLENDDDMTLTYWIGMIIGPPRTPFENRMYSLKIECG 72
            ||.|||||||||||::|||||||||:|||||:|:|||||.|.|||||||||.:|||:||||||||
Human    31 GVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIECG 95

  Fly    73 ERYPDEPPTLRFITKVNINCINQNNGVVDHRSVQMLARWSREYNIKTMLQEIRRIMTMKENLKLA 137
            .:||:.||.:||:||:|:|.:|.:|||||.|::.:||:|...|:||.:|||:||:|..|||:||.
Human    96 PKYPEAPPFVRFVTKINMNGVNSSNGVVDPRAISVLAKWQNSYSIKVVLQELRRLMMSKENMKLP 160

  Fly   138 QPPEGSCF 145
            |||||.|:
Human   161 QPPEGQCY 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uev1ANP_001286940.1 UBCc 16..142 CDD:214562 84/125 (67%)
UBE2V1NP_001244322.1 UBCc 39..165 CDD:214562 84/125 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 142 1.000 Domainoid score I4690
eggNOG 1 0.900 - - E1_KOG0896
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H81888
Inparanoid 1 1.050 222 1.000 Inparanoid score I3543
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54124
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001338
OrthoInspector 1 1.000 - - otm41945
orthoMCL 1 0.900 - - OOG6_101344
Panther 1 1.100 - - LDO PTHR24068
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2190
SonicParanoid 1 1.000 - - X939
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.860

Return to query results.
Submit another query.