DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uev1A and LOC679539

DIOPT Version :9

Sequence 1:NP_001286940.1 Gene:Uev1A / 38613 FlyBaseID:FBgn0035601 Length:145 Species:Drosophila melanogaster
Sequence 2:XP_003751372.1 Gene:LOC679539 / 679539 RGDID:1587144 Length:147 Species:Rattus norvegicus


Alignment Length:145 Identity:94/145 - (64%)
Similarity:124/145 - (85%) Gaps:0/145 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MANTSSTGVVVPRNFRLLEELDQGQKGVGDGTISWGLENDDDMTLTYWIGMIIGPPRTPFENRMY 65
            ||.|:.:||.|||||||||||::|||||||||:|||||:|:|||||.|.|||||||||.:|||:|
  Rat     1 MAATTGSGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTIYENRIY 65

  Fly    66 SLKIECGERYPDEPPTLRFITKVNINCINQNNGVVDHRSVQMLARWSREYNIKTMLQEIRRIMTM 130
            |||||||.:||:.||::||:|:||::.::.:|||||.|:..:||:|...::||.:|||:||:|..
  Rat    66 SLKIECGPKYPEAPPSVRFVTRVNMSGVSSSNGVVDPRATAVLAKWQNSHSIKVILQELRRLMMS 130

  Fly   131 KENLKLAQPPEGSCF 145
            |||:||.|||||.|:
  Rat   131 KENMKLPQPPEGQCY 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uev1ANP_001286940.1 UBCc 16..142 CDD:214562 81/125 (65%)
LOC679539XP_003751372.1 UBCc 16..142 CDD:214562 81/125 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 142 1.000 Domainoid score I4568
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H81888
Inparanoid 1 1.050 215 1.000 Inparanoid score I3530
OMA 1 1.010 - - QHG54124
OrthoDB 1 1.010 - - D1507995at2759
OrthoFinder 1 1.000 - - FOG0001338
OrthoInspector 1 1.000 - - otm46082
orthoMCL 1 0.900 - - OOG6_101344
Panther 1 1.100 - - LDO PTHR24068
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X939
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.980

Return to query results.
Submit another query.