DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uev1A and Ube2v1

DIOPT Version :9

Sequence 1:NP_001286940.1 Gene:Uev1A / 38613 FlyBaseID:FBgn0035601 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_001298060.1 Gene:Ube2v1 / 66589 MGIID:1913839 Length:173 Species:Mus musculus


Alignment Length:138 Identity:91/138 - (65%)
Similarity:119/138 - (86%) Gaps:0/138 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GVVVPRNFRLLEELDQGQKGVGDGTISWGLENDDDMTLTYWIGMIIGPPRTPFENRMYSLKIECG 72
            ||.|||||||||||::|||||||||:|||||:|:|||||.|.|||||||||.:|||:||||||||
Mouse    34 GVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIECG 98

  Fly    73 ERYPDEPPTLRFITKVNINCINQNNGVVDHRSVQMLARWSREYNIKTMLQEIRRIMTMKENLKLA 137
            .:||:.||::||:|:||::.::.:|||||.|:..:||:|...::||.:|||:||:|..|||:||.
Mouse    99 PKYPEAPPSVRFVTRVNMSGVSSSNGVVDPRATAVLAKWQNSHSIKVILQELRRLMMSKENMKLP 163

  Fly   138 QPPEGSCF 145
            |||||.|:
Mouse   164 QPPEGQCY 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uev1ANP_001286940.1 UBCc 16..142 CDD:214562 81/125 (65%)
Ube2v1NP_001298060.1 UBCc 42..168 CDD:214562 81/125 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 142 1.000 Domainoid score I4668
eggNOG 1 0.900 - - E1_KOG0896
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H81888
Inparanoid 1 1.050 215 1.000 Inparanoid score I3605
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54124
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001338
OrthoInspector 1 1.000 - - otm43993
orthoMCL 1 0.900 - - OOG6_101344
Panther 1 1.100 - - LDO PTHR24068
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2190
SonicParanoid 1 1.000 - - X939
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.