DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uev1A and ube2v2

DIOPT Version :9

Sequence 1:NP_001286940.1 Gene:Uev1A / 38613 FlyBaseID:FBgn0035601 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_001016276.1 Gene:ube2v2 / 549030 XenbaseID:XB-GENE-1015103 Length:145 Species:Xenopus tropicalis


Alignment Length:138 Identity:93/138 - (67%)
Similarity:118/138 - (85%) Gaps:0/138 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GVVVPRNFRLLEELDQGQKGVGDGTISWGLENDDDMTLTYWIGMIIGPPRTPFENRMYSLKIECG 72
            ||.:||||||||||::|||||||||:|||||:|:|||||.|.|||||||||.:|||:||||||||
 Frog     6 GVKMPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKIECG 70

  Fly    73 ERYPDEPPTLRFITKVNINCINQNNGVVDHRSVQMLARWSREYNIKTMLQEIRRIMTMKENLKLA 137
            .:||:.|||:||:||:|:|.||.:||.||.||:.:||:|...::||.:|||:||:|..|||:||.
 Frog    71 PKYPEAPPTVRFVTKMNMNGINNSNGTVDSRSIPVLAKWQNSFSIKVVLQELRRLMMSKENMKLP 135

  Fly   138 QPPEGSCF 145
            |||||..:
 Frog   136 QPPEGQTY 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uev1ANP_001286940.1 UBCc 16..142 CDD:214562 85/125 (68%)
ube2v2NP_001016276.1 UBCc 14..145 CDD:214562 87/130 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 143 1.000 Domainoid score I4620
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 220 1.000 Inparanoid score I3459
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1507995at2759
OrthoFinder 1 1.000 - - FOG0001338
OrthoInspector 1 1.000 - - otm49166
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2190
SonicParanoid 1 1.000 - - X939
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.090

Return to query results.
Submit another query.