powered by:
Protein Alignment Uev1A and CG46338
DIOPT Version :9
Sequence 1: | NP_001286940.1 |
Gene: | Uev1A / 38613 |
FlyBaseID: | FBgn0035601 |
Length: | 145 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_524888.1 |
Gene: | CG46338 / 47272 |
FlyBaseID: | FBgn0285962 |
Length: | 244 |
Species: | Drosophila melanogaster |
Alignment Length: | 39 |
Identity: | 9/39 - (23%) |
Similarity: | 19/39 - (48%) |
Gaps: | 3/39 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 48 WIGMIIGPPRTPFENRMYSLKIECGERYPDEP--PTLRF 84
|.|:..| .:..:...::...|...:|:||:. |::.|
Fly 52 WFGVFFG-RQGLYAESVFRFTILLPDRFPDDKSLPSIIF 89
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45438164 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.