DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uev1A and eff

DIOPT Version :9

Sequence 1:NP_001286940.1 Gene:Uev1A / 38613 FlyBaseID:FBgn0035601 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_001262578.1 Gene:eff / 41785 FlyBaseID:FBgn0011217 Length:147 Species:Drosophila melanogaster


Alignment Length:92 Identity:28/92 - (30%)
Similarity:45/92 - (48%) Gaps:8/92 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 SWGLENDDDMTLTYWIGMIIGPPRTPFENRMYSLKIECGERYPDEPPTLRFITKVNINCINQNNG 98
            |.|...||   |.:|...|:|||.:|::..::.|.|.....||.:||.:.|.|::....||.|..
  Fly    22 SAGPVGDD---LFHWQATIMGPPDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGS 83

  Fly    99 VVDHRSVQML-ARWSREYNIKTMLQEI 124
            :    .:.:| ::||....|..:|..|
  Fly    84 I----CLDILRSQWSPALTISKVLLSI 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uev1ANP_001286940.1 UBCc 16..142 CDD:214562 28/92 (30%)
effNP_001262578.1 UBCc 1..146 CDD:412187 28/92 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.