DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uev1A and CG7656

DIOPT Version :9

Sequence 1:NP_001286940.1 Gene:Uev1A / 38613 FlyBaseID:FBgn0035601 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_648783.4 Gene:CG7656 / 39691 FlyBaseID:FBgn0036516 Length:319 Species:Drosophila melanogaster


Alignment Length:98 Identity:31/98 - (31%)
Similarity:48/98 - (48%) Gaps:12/98 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LENDDDMTLTYWIGMIIGPPRTPFENRMYSLKIECGERYPDEPPTLRFITKV---NIN-----CI 93
            |.|||:  |..|...|.|||.|.::...:...::....||..||::||:|||   |:.     ||
  Fly    64 LINDDN--LFEWEVAIFGPPDTLYQGGYFKAHMKFPHDYPYSPPSIRFLTKVWHPNVYENGDLCI 126

  Fly    94 NQNNGVVDHRSVQML--ARWSREYNIKTMLQEI 124
            :..:..||......|  .||:...|::|:|..:
  Fly   127 SILHPPVDDPQSGELPCERWNPTQNVRTILLSV 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uev1ANP_001286940.1 UBCc 16..142 CDD:214562 31/98 (32%)
CG7656NP_648783.4 UBCc 42..186 CDD:238117 31/98 (32%)
COG5078 45..182 CDD:227410 31/98 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438201
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.