DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uev1A and CG16894

DIOPT Version :9

Sequence 1:NP_001286940.1 Gene:Uev1A / 38613 FlyBaseID:FBgn0035601 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_611455.1 Gene:CG16894 / 37280 FlyBaseID:FBgn0034483 Length:266 Species:Drosophila melanogaster


Alignment Length:100 Identity:25/100 - (25%)
Similarity:41/100 - (41%) Gaps:15/100 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 YWIGMIIGPPRTPFENRMYSLKIECGERYPDE--PPTLRFITKVNINCINQNNGVVDHRSVQMLA 109
            :|.|:|...... :...::...|...|.:|.:  .||:.|.|:|....|...|..:|  ....|.
  Fly    45 HWFGVIFVHSGI-YAGSVFRFSILLPENFPADISLPTVVFSTEVLHPHICPQNKTLD--LAHFLN 106

  Fly   110 RWSR-EYNIKTMLQEIRRIMTMKENLKLAQPPEGS 143
            .|.: |::|..:|:.|:.|..         .||||
  Fly   107 EWRKDEHHIWHVLRYIQAIFA---------DPEGS 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uev1ANP_001286940.1 UBCc 16..142 CDD:214562 22/97 (23%)
CG16894NP_611455.1 COG5078 20..176 CDD:227410 24/99 (24%)
UBCc 23..173 CDD:294101 24/99 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438165
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.