powered by:
Protein Alignment Uev1A and Kua
DIOPT Version :9
Sequence 1: | NP_001286940.1 |
Gene: | Uev1A / 38613 |
FlyBaseID: | FBgn0035601 |
Length: | 145 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001188856.1 |
Gene: | Kua / 35300 |
FlyBaseID: | FBgn0032850 |
Length: | 310 |
Species: | Drosophila melanogaster |
Alignment Length: | 45 |
Identity: | 8/45 - (17%) |
Similarity: | 19/45 - (42%) |
Gaps: | 7/45 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 STGVVVPRNFRLLEELDQGQK--GVGDGTISWGLENDDDMTLTYW 48
|..:::||....:..:...:. .:..|.::|.||. :.:|
Fly 244 SCHIILPRKHHRIHHVAPHETYFCITTGWLNWPLER-----IRFW 283
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45438140 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.