DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uev1A and CG4502

DIOPT Version :9

Sequence 1:NP_001286940.1 Gene:Uev1A / 38613 FlyBaseID:FBgn0035601 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_609103.1 Gene:CG4502 / 34002 FlyBaseID:FBgn0031896 Length:306 Species:Drosophila melanogaster


Alignment Length:144 Identity:24/144 - (16%)
Similarity:59/144 - (40%) Gaps:21/144 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RNFRLLEELDQGQK--GVGDGTISWGLENDDDMTLTYW-IGMIIGPPRTPFENRMYS-------L 67
            |..||::|..:.::  ...|...:..|.||   :|..| :.:.:..|.:|....|..       |
  Fly   139 RTRRLMKEYREMERLQAKNDAVFTVELVND---SLFEWHVRLHVIDPDSPLARDMAEMGVPAILL 200

  Fly    68 KIECGERYPDEPPTLRFI-TKVNINCINQNNGVVDHRSVQMLA--RWSREYNIKTMLQEIRRIMT 129
            .:...:.:|..||.:|.: ..:....:.:...:    .:::|.  .|:..|.::.::.:. ....
  Fly   201 HLSFPDNFPFAPPFMRVVEPHIEKGYVMEGGAI----CMELLTPRGWASAYTVEAVIMQF-AASV 260

  Fly   130 MKENLKLAQPPEGS 143
            :|...::|:.|:.:
  Fly   261 VKGQGRIARKPKST 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uev1ANP_001286940.1 UBCc 16..142 CDD:214562 23/138 (17%)
CG4502NP_609103.1 UBCc 140..>258 CDD:238117 20/125 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.