DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uev1A and CG40045

DIOPT Version :9

Sequence 1:NP_001286940.1 Gene:Uev1A / 38613 FlyBaseID:FBgn0035601 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_001036640.1 Gene:CG40045 / 3355079 FlyBaseID:FBgn0058045 Length:168 Species:Drosophila melanogaster


Alignment Length:144 Identity:37/144 - (25%)
Similarity:66/144 - (45%) Gaps:35/144 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LLEELDQGQKGVGDGTISWGLENDDDMTLTYWIGMIIGPPRTPFENRMYSLKIECGERYPDEPPT 81
            |.::|.:..|...:| .|.||.:::|  :..|..:|||||.|.:|...:...:...:.||..||.
  Fly    10 LKKQLAELNKNPVEG-FSAGLIDEND--IFRWEVLIIGPPDTLYEGGFFKAHLYFPKEYPLRPPR 71

  Fly    82 LRFITKV---NINCINQNNGVVDHRSVQML--------------ARWSREYNIKTMLQEIRRIMT 129
            ::|:|::   ||    :.||.|   .:.:|              .||...:.::|:|..   :::
  Fly    72 MKFVTEIWHPNI----EKNGDV---CISILHEPGDDKWGYEKASERWLPVHTVETILIS---VIS 126

  Fly   130 MKENLKLAQPPEGS 143
            |     ||.|.:.|
  Fly   127 M-----LADPNDES 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uev1ANP_001286940.1 UBCc 16..142 CDD:214562 36/141 (26%)
CG40045NP_001036640.1 UQ_con 10..160 CDD:395127 37/144 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438098
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.