DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uev1A and CG8188

DIOPT Version :9

Sequence 1:NP_001286940.1 Gene:Uev1A / 38613 FlyBaseID:FBgn0035601 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_001033852.1 Gene:CG8188 / 32751 FlyBaseID:FBgn0030863 Length:209 Species:Drosophila melanogaster


Alignment Length:122 Identity:31/122 - (25%)
Similarity:57/122 - (46%) Gaps:16/122 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PRNFR-LLEELDQGQKGVGDGTISWGLENDDDMTLTYWIGMIIGPPRTPFENRMYSLKIECGERY 75
            |:..| ::.||.:.:....:|...  |.|:.|:|...  .:|.||..||:...::.:|:...:.:
  Fly    13 PQTIRQVMRELQEMETTPPEGIKV--LINESDVTDIQ--ALIDGPAGTPYAAGIFRVKLTLNKDF 73

  Fly    76 PDEPPTLRFITKV---NINCINQNNGVVDHRSVQMLAR-WSREYNIKTMLQEIRRIM 128
            |..||...|:||:   |:..    ||.:   .|..|.: |..:..||.:|..|:.::
  Fly    74 PLTPPKAYFLTKIFHPNVAA----NGEI---CVNTLKKDWKPDLGIKHILLTIKCLL 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uev1ANP_001286940.1 UBCc 16..142 CDD:214562 30/118 (25%)
CG8188NP_001033852.1 COG5078 12..159 CDD:227410 31/122 (25%)
UBCc 16..155 CDD:238117 30/119 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438195
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.