DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uev1A and ben

DIOPT Version :9

Sequence 1:NP_001286940.1 Gene:Uev1A / 38613 FlyBaseID:FBgn0035601 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_001162752.1 Gene:ben / 32358 FlyBaseID:FBgn0000173 Length:151 Species:Drosophila melanogaster


Alignment Length:129 Identity:32/129 - (24%)
Similarity:56/129 - (43%) Gaps:32/129 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VVPRNFRLLEELDQGQKGVGDGTISWGLENDDDMTLTYWIGMIIGPPRTPFENRMYSLKIECGER 74
            ::....||::|...|...:.|       ||:    ..|:..::.||..:|||..::.|::...|.
  Fly     8 IIKETQRLMQEPVPGINAIPD-------ENN----ARYFHVIVTGPNDSPFEGGVFKLELFLPED 61

  Fly    75 YPDEPPTLRFITKVNINCINQNNGVVDHRSVQMLAR---------WSREYNIKTMLQEIRRIMT 129
            ||...|.:|||||:.            |.::..|.|         ||....|:|:|..|:.:::
  Fly    62 YPMSAPKVRFITKIY------------HPNIDRLGRICLDVLKDKWSPALQIRTILLSIQALLS 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Uev1ANP_001286940.1 UBCc 16..142 CDD:214562 32/123 (26%)
benNP_001162752.1 UBCc 3..149 CDD:412187 32/129 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438123
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.